DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4174 and Y43F8B.19

DIOPT Version :9

Sequence 1:NP_001034031.2 Gene:CG4174 / 40023 FlyBaseID:FBgn0036793 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001123044.2 Gene:Y43F8B.19 / 6418801 WormBaseID:WBGene00077688 Length:243 Species:Caenorhabditis elegans


Alignment Length:234 Identity:48/234 - (20%)
Similarity:80/234 - (34%) Gaps:63/234 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 KVFQLQKEICSKRYRRKSGVLVCRYVDWTPFLKLAPLKMEELSMKPYISIFYGFLGQKDIEVLKN 338
            |.|:.:..:|.: |.:...::....|.|.|.|.:            |..:|.|          |.
 Worm     3 KSFEWKHAVCFE-YLQNFQIVKVEVVAWRPGLVI------------YRDLFTG----------KQ 44

  Fly   339 VSRPKLQRIEHLSGNCSCKIGNLSTSLHDVVRKVNELILGITGFPL------KGNQMLEVINYG- 396
            | |..|:.:|||.......:.:....:...:|:.|...:.....|.      ....:|..:|:. 
 Worm    45 V-RDHLELMEHLKFEEQLVVNDDGNDIVSKIRRANGTQVFHEDHPAARSIWDTAKNLLPNLNFKT 108

  Fly   397 ----IAGNYNP--------------------EEPKIH-NKANAFIFLSNAGK-GGEIVFPSRHLK 435
                :|.:|||                    |..::: |:....|....|.: ||..|||.....
 Worm   109 AEDILALSYNPGGHYAAHHDYLLYPSEKEWDEWMRVNGNRFGTLIMAFGAAESGGATVFPRLGAA 173

  Fly   436 VRPRKGSMLVWENL-----KKSLIYHQ-CPILKGNMWVA 468
            ||.:.|....|.|.     ::.|..|. |||.||...::
 Worm   174 VRTKPGDAFFWFNAMGNSEQEDLSEHAGCPIYKGQKQIS 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4174NP_001034031.2 P4Ha_N 33..157 CDD:285528
TPR repeat 169..197 CDD:276809
TPR repeat 202..245 CDD:276809
2OG-FeII_Oxy <362..470 CDD:304390 30/146 (21%)
Y43F8B.19NP_001123044.2 P4Hc 43..217 CDD:214780 37/171 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.