DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4174 and p4ha1a

DIOPT Version :9

Sequence 1:NP_001034031.2 Gene:CG4174 / 40023 FlyBaseID:FBgn0036793 Length:473 Species:Drosophila melanogaster
Sequence 2:XP_009304776.1 Gene:p4ha1a / 562774 ZFINID:ZDB-GENE-040724-91 Length:541 Species:Danio rerio


Alignment Length:519 Identity:128/519 - (24%)
Similarity:218/519 - (42%) Gaps:96/519 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DFAISSESQLSLLKLKETHVNNLQSYKKVLKKHLQKIRRAIRQSEELLKSTKTSPRNL----IYG 88
            ||..|......||..::..|.:|:.|.|..:..|:::::...:.:.|..:....|...    :..
Zfish    24 DFFTSIGHMTDLLFTEKDLVTSLKDYIKAEESKLEQVKQWAEKLDALTATAVQDPEGFLGHPVNA 88

  Fly    89 YKVLRHLHNDWPQYFRLLKKDL--GLEQIAVSQMLLTQQ--PTSVDFEESMGAMHRLQTVYNLDS 149
            :|:::.|:.:|.:...|:.||:  |.    :|.:.:.:|  |...|...:..|:.|||..|.||:
Zfish    89 FKLMKRLNTEWGEVEDLVLKDMSDGF----ISNLTIQRQYFPNDEDQNGAAKALLRLQDTYKLDT 149

  Fly   150 YAMTEGFIDDKDKNI---RNWSADECLMLGLMYLFLKDYNQSENWLELALYHYDDNVSPEVLKIK 211
            ..::.|.:...:..:   ...:.::|..||.:.....||..:|.|:..||...|:..        
Zfish   150 QTISSGDLPGVNTGLPYKSTLTVEDCFELGKIAYSDADYYHTELWMAQALKQLDEGE-------- 206

  Fly   212 LWNYPNLLESLVEANKGL----------GHYFEAKKYANELLSINPNH----------TYMLTQL 256
                    ||.||....|          |....|.:|...||::.|.|          .|.|.:.
Zfish   207 --------ESSVEIATALDYLSYSVYQQGELERALEYTKRLLTVEPEHQRALGNLKYFDYQLAKQ 263

  Fly   257 PKLKHLQSNPAKLTKPKKVFQLQKE----------ICS----KRYRRKSGVLVCRYVDWT--PFL 305
            .|.:..||...:..|.::....:||          :|.    |...|:...|.|||.:..  ||.
Zfish   264 KKAEKEQSTKEESKKEQETSDGKKEYLPEKRKYEKLCRGEGLKMTPRRQKHLFCRYFNGNRHPFY 328

  Fly   306 KLAPLKMEELSMKPYISIFYGFLGQKDIEVLKNVSRPKLQRI---EHLSGNCSCKIGNLSTSL-- 365
            .:.|:|.|:...:|.|..::..:.:::||.:|.:|:|:|:|.   ..::|........:|.|.  
Zfish   329 TIGPVKQEDEWDRPRIIRYHEIITEQEIEKIKELSKPRLRRATISNPITGVLETAHYRISKSAWL 393

  Fly   366 ----HDVVRKVNELILGITGFPLKGNQMLEVINYGIAGNYNP-------EEPKIHNK-------A 412
                |.||.::|:.|..|||..:|..:.|:|.|||:.|.|.|       :||....:       |
Zfish   394 AAYEHPVVDRINQRIEDITGLNVKTAEELQVANYGVGGQYEPHFDFGRKDEPDAFKELGTGNRIA 458

  Fly   413 NAFIFLSNAGKGGEIVFPSRHLKVRPRKGSMLVWENL------KKSLIYHQCPILKGNMWVANK 470
            ....::|:...||..|||.....|:|.||:.:.|.||      ..|..:..||:|.||.||:||
Zfish   459 TWLFYMSDVAAGGATVFPEVGAAVKPLKGTAVFWYNLFPSGEGDYSTRHAACPVLVGNKWVSNK 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4174NP_001034031.2 P4Ha_N 33..157 CDD:285528 28/131 (21%)
TPR repeat 169..197 CDD:276809 8/27 (30%)
TPR repeat 202..245 CDD:276809 10/52 (19%)
2OG-FeII_Oxy <362..470 CDD:304390 43/133 (32%)
p4ha1aXP_009304776.1 P4Ha_N 28..157 CDD:285528 29/132 (22%)
TPR repeat 172..207 CDD:276809 10/50 (20%)
TPR repeat 212..242 CDD:276809 6/29 (21%)
Fis1 218..262 CDD:304536 9/43 (21%)
P4Hc 352..525 CDD:214780 53/171 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583441
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.