DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4174 and P4HA1

DIOPT Version :9

Sequence 1:NP_001034031.2 Gene:CG4174 / 40023 FlyBaseID:FBgn0036793 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_000908.2 Gene:P4HA1 / 5033 HGNCID:8546 Length:534 Species:Homo sapiens


Alignment Length:546 Identity:134/546 - (24%)
Similarity:233/546 - (42%) Gaps:101/546 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLFHFVVVTACLGFQVKGEVVSAPESY---DFAISSESQLSLLKLKETHVNNLQSYKKVLKKHLQ 62
            |:::.:::...|           |:|.   .|..|......|:..::..|.:|:.|.|..:..|:
Human     1 MIWYILIIGILL-----------PQSLAHPGFFTSIGQMTDLIHTEKDLVTSLKDYIKAEEDKLE 54

  Fly    63 KIRRAIRQSEELLKSTKTSPRNL----IYGYKVLRHLHNDWPQYFRLLKKDL--GLEQIAVSQML 121
            :|::...:.:.|..:....|...    :..:|:::.|:.:|.:...|:.||:  |.    :|.:.
Human    55 QIKKWAEKLDRLTSTATKDPEGFVGHPVNAFKLMKRLNTEWSELENLVLKDMSDGF----ISNLT 115

  Fly   122 LTQQ--PTSVDFEESMGAMHRLQTVYNLDSYAMTEGFIDD-KDKNIRNWSADECLMLGLMYLFLK 183
            :.:|  |...|...:..|:.|||..||||:..:::|.:.. |.|:.  .:|::|..||.:.....
Human   116 IQRQYFPNDEDQVGAAKALLRLQDTYNLDTDTISKGNLPGVKHKSF--LTAEDCFELGKVAYTEA 178

  Fly   184 DYNQSENWLELALYHYDDNVSPEVLKIKLWNYPNLLESLVEANKGLGHYFEAKKYANELLSINPN 248
            ||..:|.|:|.||...|:.....:.|:.:.:|      |..|....|...:|.....:||.::|.
Human   179 DYYHTELWMEQALRQLDEGEISTIDKVSVLDY------LSYAVYQQGDLDKALLLTKKLLELDPE 237

  Fly   249 HTYMLTQLPKLKHLQSNPAKLTK------------PKK---------VFQLQKEICS----KRYR 288
            |......|...:::.:....:.|            |||         ..|..:.:|.    |...
Human   238 HQRANGNLKYFEYIMAKEKDVNKSASDDQSDQKTTPKKKGVAVDYLPERQKYEMLCRGEGIKMTP 302

  Fly   289 RKSGVLVCRYVDW--TPFLKLAPLKMEELSMKPYISIFYGFLGQKDIEVLKNVSRPKLQRIE-HL 350
            |:...|.|||.|.  .|...|||.|.|:...||.|..|:..:...:||::|::::|:|.|.. | 
Human   303 RRQKKLFCRYHDGNRNPKFILAPAKQEDEWDKPRIIRFHDIISDAEIEIVKDLAKPRLSRATVH- 366

  Fly   351 SGNCSCKIGNLSTSLH-------------DVVRKVNELILGITGFPLKGNQMLEVINYGIAGNYN 402
                ..:.|.|:|:.:             .||.::|..|..:||..:...:.|:|.|||:.|.|.
Human   367 ----DPETGKLTTAQYRVSKSAWLSGYENPVVSRINMRIQDLTGLDVSTAEELQVANYGVGGQYE 427

  Fly   403 P-------EEPKIHNK-------ANAFIFLSNAGKGGEIVFPSRHLKVRPRKGSMLVWENL---- 449
            |       :||....:       |....::|:...||..|||.....|.|:||:.:.|.||    
Human   428 PHFDFARKDEPDAFKELGTGNRIATWLFYMSDVSAGGATVFPEVGASVWPKKGTAVFWYNLFASG 492

  Fly   450 --KKSLIYHQCPILKGNMWVANKVLN 473
              ..|..:..||:|.||.||:||.|:
Human   493 EGDYSTRHAACPVLVGNKWVSNKWLH 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4174NP_001034031.2 P4Ha_N 33..157 CDD:285528 29/131 (22%)
TPR repeat 169..197 CDD:276809 10/27 (37%)
TPR repeat 202..245 CDD:276809 8/42 (19%)
2OG-FeII_Oxy <362..470 CDD:304390 39/140 (28%)
P4HA1NP_000908.2 P4Ha_N 25..112 CDD:400573 16/90 (18%)
TPR 205..238 8/38 (21%)
P4Hc 345..518 CDD:214780 50/177 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.