DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4174 and CG31021

DIOPT Version :9

Sequence 1:NP_001034031.2 Gene:CG4174 / 40023 FlyBaseID:FBgn0036793 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_733392.2 Gene:CG31021 / 43638 FlyBaseID:FBgn0051021 Length:453 Species:Drosophila melanogaster


Alignment Length:474 Identity:109/474 - (22%)
Similarity:203/474 - (42%) Gaps:66/474 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LLKLKETHVNNLQSYKKVLKKHLQKIRRAIRQSEELLKSTKTSPR----NLIYGYKVLRHLHNDW 99
            :|.|:...:.|::.|.:.|::.:..|...:......::.....|.    |.:..::::||:|.||
  Fly     1 MLNLERNLLQNMRDYAEKLEEKIDLINNYVEDYNVDIEDANEDPEKYLSNPLNSFRLIRHMHQDW 65

  Fly   100 PQYFRLLKKDLGLEQIAVSQMLLTQQPTSVDFEESMGAMHRLQTVYNLDSYAMTEGFIDDKDKNI 164
            ..:...::..:..|.:...:.||.|.|....|.::..::|.|...|   .|...:....|:..:.
  Fly    66 VGWQVYMEDLVAPEAVQKVESLLPQLPQKEAFRKAARSVHSLTQFY---GYEPADLVAKDERSSS 127

  Fly   165 RNWSADECLMLGLMYLFLKDYNQSENWLELALYHYD-----DNVSPEVLKIKLWN-YPNLLESLV 223
            .:.|..:|..|||.....:||..:..||::|.::|.     |..:|  |....|. |.:|..:|:
  Fly   128 LHLSPLDCYHLGLELYEEQDYLGAAKWLQVAAHNYTLSRHRDLFNP--LGAPRWQVYRDLGRTLL 190

  Fly   224 EANKGLGHYFEAKKYANELLSINPNHTYMLTQLPKLK------------HLQSNPAKLTKPKKVF 276
            :.|:...  ::|.:.|   |.:|..:.:::.:..:::            .||..|..|.|     
  Fly   191 KLNRQCA--YDAYESA---LRLNSQNVHLMKEAGQMELFSLRDPMEPILDLQPKPTVLEK----- 245

  Fly   277 QLQKEICSKRYRRKSGVLVCRYVDWT-PFLKLAPLKMEELSMKPYISIFYGFLGQKDIEVLKNVS 340
                 .|.....|..|.|.|...||. .||..||:|.|:|...|:|.::.|.:.:::|..::|..
  Fly   246 -----YCRGEVPRHQGRLTCELNDWVHSFLAYAPIKFEDLQQDPFIILYPGSIYEQEIRHVENAY 305

  Fly   341 R--PKLQRIEHLSGNCSCKIGNLSTSLHDVVRKVNELILGITGFPLKGNQMLEVINYGIAGNYNP 403
            .  |...|.|...|...|.|   |.....|::::||.||.:.|.. |......::.|.....:.|
  Fly   306 ERCPPNDRFELKLGISGCSI---SDGYSPVLKRINERILDMAGVE-KTWDTFYIVEYAQLAPFEP 366

  Fly   404 --------EEPKIH------NKANAFIFLSNAGKGGEIVFPSRHLKVRPRKGSMLV-WENLKKSL 453
                    :.||::      .:|...|||.:...||....|:..:.|:|::|::|: :||.:.|.
  Fly   367 FKLFRNSTKFPKLNLMNFEDVEAKVIIFLKDVTLGGAFTMPNGDILVQPKRGNVLITFENEEHST 431

  Fly   454 IYHQCPILKGNMWVANKVL 472
            ..  |||::|...|..|.:
  Fly   432 TI--CPIIEGTGLVMIKFI 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4174NP_001034031.2 P4Ha_N 33..157 CDD:285528 23/121 (19%)
TPR repeat 169..197 CDD:276809 9/27 (33%)
TPR repeat 202..245 CDD:276809 10/43 (23%)
2OG-FeII_Oxy <362..470 CDD:304390 31/122 (25%)
CG31021NP_733392.2 P4Ha_N 1..119 CDD:285528 23/120 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452372
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10869
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.080

Return to query results.
Submit another query.