DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4174 and CG15539

DIOPT Version :9

Sequence 1:NP_001034031.2 Gene:CG4174 / 40023 FlyBaseID:FBgn0036793 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001036776.1 Gene:CG15539 / 43627 FlyBaseID:FBgn0039782 Length:509 Species:Drosophila melanogaster


Alignment Length:491 Identity:131/491 - (26%)
Similarity:225/491 - (45%) Gaps:69/491 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DFAISSESQLSLLKLKETHVNNLQSYKKVLKKHLQKIRRAIRQSE-ELLKSTKTSPRNLIYGYKV 91
            ::|||......|:..:...:|.||.:...|:|.:..:...:..:: :..|:....|   |..:::
  Fly    29 NYAISIYDMSKLIDYEHYLLNILQKFANALQKRVDTLEYYLEMTDYDREKNLAEDP---IKHFRI 90

  Fly    92 LRHLHNDW--------PQYFRLLKKDLGLEQIAVSQMLLTQQPTSVDFEESMGAMHRLQTVYNLD 148
            .|.||:|:        .|.:..|.||:    ||::    .:.||..|.||::..:..:|..|:|.
  Fly    91 TRRLHSDYVNWVWFMEEQPWGTLVKDI----IAIA----PEMPTLKDVEEAIRGLRLIQWTYSLP 147

  Fly   149 SYAMTEGFIDDKDKNIRNWSAD--ECLMLGLMYLFLKDYNQSENWLELALYHYDDNVSPEVLKIK 211
            :..|.:|.:.|..   .|.|.|  :|:.:....:..||:.:::.||.:.|..|:.:...|.:..:
  Fly   148 TAEMAKGVLQDIH---HNTSLDGMQCITIARHMVNYKDFIRAKEWLMVGLKMYEADEEIEYIYSQ 209

  Fly   212 LWNYP--NLLESLVEANKGLGHYFEAKKYANELLSINPNHTYMLTQLPKLK---HLQSNPA-KLT 270
            | ..|  :..|..||....||..:.|.......:...|....:...|.:||   .:...|| |..
  Fly   210 L-GMPLVDFYELFVEIQDELGSRYLAMSELQLAIKNWPEKVSLQRALSRLKMNIRIGKEPAEKKN 273

  Fly   271 KPKKVFQLQKEICSKRYRRKSGVLVCRYVDWTP-FLKLAPLKMEELSMKPYISIFYGFLGQKDIE 334
            |.|:|:   |:.||... |.:..|.|.|...:. ||:|||||||.||:.||:.:|:..:..|||.
  Fly   274 KSKRVY---KKCCSSEC-RPTAKLYCLYKTTSSYFLRLAPLKMELLSLDPYMVLFHDVVSDKDIV 334

  Fly   335 VLKNVSRPKLQRIEHLSGNCSCKIGNLS------------TSLHDVVRKVNELILGITGFPLKGN 387
            .::|:::.||.|...:|     |.||.:            ...:.:::::::|...:|.|.:...
  Fly   335 SIRNLTKGKLARTVTVS-----KDGNYTEDPDRTTKGTWLVENNALIQRLSQLTQDMTNFDIHDA 394

  Fly   388 QMLEVINYGIAGNYN-----PEEPKIHN----KANAFIFLSNAGKGGEIVFPSRHLKVRPRKGSM 443
            ...:|:||||.|.|.     .|:.::.|    .|.|..:||:..:||..:||...|.|.|:|||.
  Fly   395 DPFQVLNYGIGGFYGIHFDFLEDAELDNFSDRIATAVFYLSDVPQGGATIFPKLGLSVFPKKGSA 459

  Fly   444 LVWENL------KKSLIYHQCPILKGNMWVANKVLN 473
            |:|.||      .....:..||.:.|:.||..|.:|
  Fly   460 LLWYNLDHKGDGDNRTAHSACPTVVGSRWVMTKWIN 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4174NP_001034031.2 P4Ha_N 33..157 CDD:285528 29/132 (22%)
TPR repeat 169..197 CDD:276809 6/29 (21%)
TPR repeat 202..245 CDD:276809 9/44 (20%)
2OG-FeII_Oxy <362..470 CDD:304390 35/134 (26%)
CG15539NP_001036776.1 P4Ha_N 33..156 CDD:285528 30/133 (23%)
P4Hc 329..494 CDD:214780 47/169 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461867
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.