DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4174 and PH4alphaMP

DIOPT Version :9

Sequence 1:NP_001034031.2 Gene:CG4174 / 40023 FlyBaseID:FBgn0036793 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_524594.2 Gene:PH4alphaMP / 43624 FlyBaseID:FBgn0026190 Length:535 Species:Drosophila melanogaster


Alignment Length:524 Identity:125/524 - (23%)
Similarity:230/524 - (43%) Gaps:80/524 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLFHFVVVTACLGFQVKGEVVSAPESYDFAISSESQLSLLKLKETHVNNLQSYKKVLKKHLQKIR 65
            :||..:.|.:|     .||..|:...  .|...|:::.||...:.:||.:..:.:.|:..:..||
  Fly     7 VLFLVLQVLSC-----HGEFFSSTSG--LAKLFETEVVLLAELQNYVNEINQHAEALQSEIDAIR 64

  Fly    66 RAIRQSEELLKSTKTSPRNLIYGYKVLRHLHNDWPQYFRLLKKDLGLEQIAVSQMLLTQQ---PT 127
            .....:.:.:.....:|.|   .:::::.||:||..:...:..|........:...|.:.   |:
  Fly    65 VEHLNAADGIDDYLNNPVN---AFRLIKRLHSDWETFEGSVTADSSRSNYLDTMASLKENLSFPS 126

  Fly   128 SVDFEESMGAMHRLQTVYNLDSYAMTEGFIDD-KDKNIRNWSADECLMLGLMYLFLKDYNQSENW 191
            ..||..|..|:.|||..|.||...:..|.::. |.....:|  .:|.:||.....|:|||.:..|
  Fly   127 QDDFVGSAIALTRLQQTYQLDVAELASGILNGVKYGTAMSW--QDCFVLGQHLYALRDYNHTVPW 189

  Fly   192 LELALYHY-DDNVSPEVLKIKLWNYPNLLESLVEANKGLGHYFEAKKYANELLSINPN-HTYMLT 254
            |:.::... :.:...|...:      :.:|::||.::.:|.:..|....|.:|||.|: .:::|.
  Fly   190 LQQSMQLLGEQSYGSESASL------DFMEAVVEYHREMGAHESALSLVNHVLSIEPDQRSHLLE 248

  Fly   255 QLPKLKHLQSNPAK-----LT--KP-----KKVFQLQKEIC--------SKRYRRKSGVLVCRYV 299
            ...:|:.|.::..|     ||  :|     .:.|::.:::|        ||:...:..:...|  
  Fly   249 ARQQLEELITDGDKNGLLHLTARRPGDYHESREFRMYEQVCRGELAPLPSKQRNLRCRLRKSR-- 311

  Fly   300 DWTPFLKLAPLKMEELSMKPYISIFYGFLGQKDIEVLKNVSRPKLQR--IEHLSGNCSCKIGNLS 362
                 |..||.|:|||.:.|.:...:..:|.||.:.|:..:||:::|  :..|.||.........
  Fly   312 -----LGYAPFKLEELHLDPLVVQLHQVIGSKDSDSLQKTARPRIKRSTVYSLGGNGGSTAAAFR 371

  Fly   363 T--------SLHDVVRKVNELILGITGFPLKGNQMLEVINYGIAGNYNP-----------EEPKI 408
            |        |.:...:.::..:...:|..:...:.|:|.||||.|:|.|           :|..:
  Fly   372 TSQGASFNYSRNAATKLLSRHVGDFSGLNMDYAEDLQVANYGIGGHYEPHWDSFPENHIYQEGDL 436

  Fly   409 HNK--ANAFIFLSNAGKGGEIVFPSRHLKVRPRKGSMLVWENLKKS------LIYHQCPILKGNM 465
            |..  |....:|::...||...||...|.|.|.:||:|.|.||..|      ..:..||:|:|:.
  Fly   437 HGNRMATGIYYLADVEAGGGTAFPFLPLLVTPERGSLLFWYNLHPSGDQDFRTKHAACPVLQGSK 501

  Fly   466 WVAN 469
            |:||
  Fly   502 WIAN 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4174NP_001034031.2 P4Ha_N 33..157 CDD:285528 28/126 (22%)
TPR repeat 169..197 CDD:276809 9/27 (33%)
TPR repeat 202..245 CDD:276809 8/42 (19%)
2OG-FeII_Oxy <362..470 CDD:304390 37/135 (27%)
PH4alphaMPNP_524594.2 P4Ha_N 24..156 CDD:285528 29/136 (21%)
P4Hc 336..509 CDD:214780 47/170 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461869
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.