DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4174 and CG11828

DIOPT Version :9

Sequence 1:NP_001034031.2 Gene:CG4174 / 40023 FlyBaseID:FBgn0036793 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_651648.5 Gene:CG11828 / 43416 FlyBaseID:FBgn0039616 Length:458 Species:Drosophila melanogaster


Alignment Length:489 Identity:126/489 - (25%)
Similarity:210/489 - (42%) Gaps:104/489 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SLLKLKETHVNNLQSYKKVLKKHLQKIRRAIRQSEELLKSTKTSP-------RNLIYGYKVLRHL 95
            |||::::..:..::.|...|:..:..:|..   .||.:......|       .|.:..:.::|..
  Fly     3 SLLQIEDELIGYMRQYAMELQHKVNTMRTF---QEEWMTRRALGPADPTSYVANPLISFPLMRRT 64

  Fly    96 HNDWPQYFRLLKK-----------DLGLEQIAVSQMLLTQQPTSVDFEESMGAMHRLQTVYNLDS 149
            :.|.|:...|.::           |..|..|           :.|:.|.::..|.|.|.||.:|.
  Fly    65 YTDVPKLLELAREEFKPGPFQKFIDYDLSSI-----------SDVELETAVTGMLRFQGVYGMDE 118

  Fly   150 YAMTEGFIDDKDKNIRNWSADECLMLGLMYLFLKDYNQSE---NWLELALYHYDDNVSP------ 205
            ..|..|.:..|..|.| .||.:||.:.   ..|::.::.:   .|.::|:..|::.:.|      
  Fly   119 SEMANGKL
HGKQYNSR-MSAADCLAVA---THLENVDKGKLACKWFKVAIDQYEEKLDPVNRLLQ 179

  Fly   206 -------EVLKIKLWNYPNLLESLVEANKGLGHYFEAKKYANELLSINPNHTYMLTQLPKLKHLQ 263
                   |.|.:.|....:|..|.......:|.   |.|..|..|:               |||:
  Fly   180 TGRSQIYEKLGLTLLAMHDLPASQAAFRDSIGW---ASKEDNTDLA---------------KHLK 226

  Fly   264 SNPAKLTKPKKVFQLQKEICSKRYRRKSGVLVCRYV-DWTPFLKLAPLKMEELSMKPYISIFYGF 327
            ...|.:.......:.:..:.||.|.|      |||: |.:|||::||:|:|:|:::|::.:|:..
  Fly   227 DKLAHMFVHVDNCRGKNLLPSKSYLR------CRYLRDGSPFLRMAPVKLEQLNIEPFVGLFHDA 285

  Fly   328 LG---QKDIEVLKNVSRPKLQRIEHLSGNCSCKIGNLSTSLHDVVRKVNELILGITGFPLKGNQM 389
            :.   |||:..|.:      .|:||...:.|.....:.|:..|.||::::.|..||||.|:.::.
  Fly   286 ISPAEQKDLLHLTD------SRLEHRKKDSSSVEAKVDTNASDHVRRIHQRIEDITGFDLEESEP 344

  Fly   390 LEVINYGIAGN-------YNPEE-----PKIHNKANAFIFLSNAGKGGEIVFPSRHLKVRPRKGS 442
            |.|.||||.|.       ..|:|     ||.:..|:|..:||:...||...||......:||:||
  Fly   345 LTVSNYGIGGQDFIHLDCEQPKEFIGYYPKEYRSASAMFYLSDVQMGGYASFPDLGFGFKPRRGS 409

  Fly   443 MLVWENLKKS------LIYHQCPILKGNMWVANK 470
            .|||.|...|      .:...||:|.||.|||.|
  Fly   410 ALVWHNTDNSGNCDTRSLQATCPVLLGNQWVAKK 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4174NP_001034031.2 P4Ha_N 33..157 CDD:285528 27/136 (20%)
TPR repeat 169..197 CDD:276809 6/30 (20%)
TPR repeat 202..245 CDD:276809 11/55 (20%)
2OG-FeII_Oxy <362..470 CDD:304390 46/125 (37%)
CG11828NP_651648.5 P4Ha_N 1..126 CDD:285528 27/136 (20%)
P4Hc 287..445 CDD:214780 55/163 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461871
Domainoid 1 1.000 59 1.000 Domainoid score I3907
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.