DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4174 and CG34041

DIOPT Version :9

Sequence 1:NP_001034031.2 Gene:CG4174 / 40023 FlyBaseID:FBgn0036793 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster


Alignment Length:339 Identity:80/339 - (23%)
Similarity:141/339 - (41%) Gaps:72/339 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 AISSESQLSLLKLKETHVNNLQSYKKVLKKHLQKIRRAI-------RQSEELLKSTKTSPRNLIY 87
            ::|....:::||::|..|..|::|...|:..|:.|..|:       .|.|....:..:||   :.
  Fly   258 SLSKSKVINILKIQENVVKYLENYIYALETKLKTIDEALIDLATYHIQFERDKLAIASSP---VA 319

  Fly    88 GYKVLRHLHNDWPQYFRLLKKDLGLEQIAVSQMLLTQQPTSVDFEESMGAMHRLQTVYNLDSYAM 152
            .|.::.|:.:||..:...|::|.|.:::|....:....||..|..|....:.::...|.:.:..:
  Fly   320 SYSLIHHMQSDWTHWQLFLQEDPGKDELASLMSIKKYLPTKNDISEVCHGISKMLNAYLMTAQDI 384

  Fly   153 TEGFI-DDKDKNIRN-----------------WSADECLMLGLMYLFLKDYNQSENWLELAL--- 196
            ..|.| ..:.|.|.:                 .|..:|:.|....:.:||||:|:.||.:|:   
  Fly   385 ANGVILGTQTKYISSALKLEYLYMEIICNRHLMSLRDCVALSDHSMEMKDYNKSKEWLNVAISML 449

  Fly   197 --YHYDDNVSPEV---LK-----IKLWNYPNLLESLVEANKGLGHYFEAKKYANELLSINPNHTY 251
              ..|.|.:.|..   ||     :|..|:...||::..|                 |..||.:..
  Fly   450 ESSAYWDPIVPSADLYLKLAEVYVKQQNWTLALETVEFA-----------------LKSNPRNAQ 497

  Fly   252 MLTQLPKLK-HLQSNPAKLTKPKKVFQLQKEICSKRYR-RKSGVLVCRYVDW---TPFLKLAPLK 311
            ::....:|. |:...|.|  .||      ..|.:..|| ||:|.|.|.| |.   |.:..|||:|
  Fly   498 LIRMQKRLSYHILLGPPK--SPK------LNIENNDYRLRKNGSLYCFY-DTKIRTFYSLLAPIK 553

  Fly   312 MEELSMKPYISIFY 325
            .|.|.:.|.:.:::
  Fly   554 AEVLFIDPLVILYH 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4174NP_001034031.2 P4Ha_N 33..157 CDD:285528 28/130 (22%)
TPR repeat 169..197 CDD:276809 10/32 (31%)
TPR repeat 202..245 CDD:276809 9/50 (18%)
2OG-FeII_Oxy <362..470 CDD:304390
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528
P4Ha_N 260..389 CDD:285528 29/131 (22%)
TPR repeat 452..491 CDD:276809 11/55 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461977
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.