DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4174 and P4ha3

DIOPT Version :9

Sequence 1:NP_001034031.2 Gene:CG4174 / 40023 FlyBaseID:FBgn0036793 Length:473 Species:Drosophila melanogaster
Sequence 2:XP_038938408.1 Gene:P4ha3 / 361612 RGDID:735150 Length:549 Species:Rattus norvegicus


Alignment Length:518 Identity:122/518 - (23%)
Similarity:213/518 - (41%) Gaps:109/518 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EVVSAPESYDFAISSESQL-----SLLKLKETHVNNL-QSYKKVLKKHLQKIRRAIRQSEELLKS 77
            :..||..|...|::.|.:|     ..|:.:|..:.:| :.|.|||..|            |.||.
  Rat    29 DTFSALTSVARALAPERRLLGTLRRYLRGEEARLRDLTRFYDKVLSLH------------EDLKI 81

  Fly    78 TKTSPRNLIYGYKVLRHLHNDWPQYFRLLK--------KDLGLEQIAVSQMLLTQQPTSVDFEES 134
            ...:|   :..:.:::.|.:||......|:        || |.|:  |.|.|    |...|.|.:
  Rat    82 PVVNP---LLAFTLIKRLQSDWRNVVHSLEATENIRALKD-GYEK--VEQDL----PAFEDLEGA 136

  Fly   135 MGAMHRLQTVYNLDSYAMTEGF--------IDD--KDKNIRNWSADECLMLGLMYLFLKDYNQSE 189
            ..|:.|||.||.|:...:.:|.        |.|  ..:.:.:.:||:|..:|.:.....||..:.
  Rat   137 ARALMRLQDVYMLNVKGLAQGVFQRVTGSSITDLYSPRQLFSLTADDCFQVGKVAYDTGDYYHAI 201

  Fly   190 NWLELAL---------YHYDDNVSPEVLKIKLWNYPNLLESLVEANKGLGHYFEAKKYANELLSI 245
            .|||.|:         :..:|..|.|          :.|:.|..|...:|:...|...:.|.|..
  Rat   202 PWLEEAVSLFRRSYGEWKTEDEASLE----------DALDYLAFACYQVGNVSCALSLSREFLVY 256

  Fly   246 NPNHTYMLTQLPKLK-------HLQSNPAKLTKPKKVFQLQ-----KEICS------KRYRRKSG 292
            :|::..|...:.|.:       ||.:....:.:| .|..||     :.:|.      ..|:..| 
  Rat   257 SPDNKRMARNVLKYERLLAENGHLMAAETAIQRP-NVPHLQTRDTYEGLCQTLGSQPTHYQIPS- 319

  Fly   293 VLVCRY-VDWTPFLKLAPLKMEELSMKPYISIFYGFLGQKDIEVLKNVSRPKLQRIEHLSGNCSC 356
             |.|.| .:.:|:|.|.|.:.|.:.::|.:::::.|:..::.:.::.::.|.|||....||....
  Rat   320 -LYCSYETNSSPYLLLQPARKEVIHLRPLVALYHDFVSDEEAQKIRELAEPWLQRSVVASGEKQL 383

  Fly   357 KIG---NLSTSLHDVVRKV----NELILGITGFPLKG--NQMLEVINYGIAGNYNPE-------- 404
            ::.   :.|..|.|.|..|    :..|..:||..::.  .:.|:|:||||.|:|.|.        
  Rat   384 QVEYRISKSAWLKDTVDPVLVTLDRRIAALTGLDIQPPYAEYLQVVNYGIGGHYEPHFDHATSPS 448

  Fly   405 ----EPKIHNK-ANAFIFLSNAGKGGEIVFPSRHLKVRPRKGSMLVWENLKKSLIYHQCPILK 462
                :.|..|: |...|:||:...||...|...:..|...|.....:.::.::......||||
  Rat   449 SPLYKMKSGNRVATLMIYLSSVEAGGATAFIYGNFSVPVVKWPTSGYTSMDRNSEDPAAPILK 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4174NP_001034031.2 P4Ha_N 33..157 CDD:285528 36/145 (25%)
TPR repeat 169..197 CDD:276809 10/36 (28%)
TPR repeat 202..245 CDD:276809 9/42 (21%)
2OG-FeII_Oxy <362..470 CDD:304390 32/120 (27%)
P4ha3XP_038938408.1 P4Ha_N 34..108 CDD:400573 19/88 (22%)
P4Hc 356..>478 CDD:214780 31/121 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343170
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.