DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4174 and PH4alphaNE3

DIOPT Version :9

Sequence 1:NP_001034031.2 Gene:CG4174 / 40023 FlyBaseID:FBgn0036793 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_651814.1 Gene:PH4alphaNE3 / 326114 FlyBaseID:FBgn0051017 Length:481 Species:Drosophila melanogaster


Alignment Length:476 Identity:120/476 - (25%)
Similarity:221/476 - (46%) Gaps:55/476 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DFAISSESQLSLLKLKETHVNNLQSYKKVLKKHLQKIRRAIRQSEELLKSTKTSPR----NLIYG 88
            :|..:..:::.|::|....::||.:|.:.:.:...:::|..::..:.|.|.|....    |.::.
  Fly    16 EFLDTESAKMDLMQLDVELIDNLMNYAEKIDEKASQLKRLAQELRQPLHSAKGREEEYLGNPLHS 80

  Fly    89 YKVLRHLHNDWPQYFRLLKKDLGLEQIAVSQMLLTQQPTSVDFEESMGAMHRLQTVYNLDSYAMT 153
            :.::||::.||......:||.:|.|:|...:..|.:.|..||.||:..::.|:...|.:..:.|.
  Fly    81 FPLIRHMYQDWRYLEEFMKKPVGEEEIQFLRRKLPELPWQVDTEEASVSIFRIAETYGMMPWDMA 145

  Fly   154 EGFIDDKDKNIR---NWSADECLMLGLMYLFLKDYNQSENWLELALYHYDDNVSP--EVLKIKLW 213
            .|.||    |:|   ...|.:|..:..||.....:.|:..|:.::.....:..|.  |||.:...
  Fly   146 NGLID----NVRFNSTLPALDCFEVAKMYFKWGYFKQALQWITISKARMKEEYSGVYEVLGMNRQ 206

  Fly   214 NYPNLLES--LVEANKGLGHYFEAKKYANELLSINP----NHTYMLTQLPKLKHLQSNPAK-LTK 271
            :.. ||::  |||.::        :..|:|:|...|    |...:|.|      .::||.: :..
  Fly   207 DVA-LLQARCLVELDR--------RDEAHEVLLDQPDLADNSISLLDQ------FKANPYEAIDS 256

  Fly   272 PKKVFQLQKEICSKRYRRKSGVLVCRYVDWT-PFLKLAPLKMEELSMKPYISIFYGFLGQKDIEV 335
            ..|:.:..|.:|...:......|.|||...| .||.||||||||:|::|:|.:::..|..|||:.
  Fly   257 SPKLGEGYKRLCRSSFSPNPSKLHCRYNSTTSAFLILAPLKMEEISLEPHIVVYHDILPDKDIQQ 321

  Fly   336 LKNVSRPKLQRIEHLSGNCSCKIGNLSTSL-HDVVRKVNELILGITGFPLKGNQMLEVINYGIAG 399
            |..::.|.|:..|....|.:....:..|.| ..::..:.:.:..|||..::....:.:|.||...
  Fly   322 LITLAEPLLKPTEMFDDNKNEARSSYRTPLGGPLLDSLTQRMRDITGLQIRQGNPINIIKYGFGA 386

  Fly   400 NY----------NPEEPKIHNKANAFIF-LSNAGKGGEIVFPSRHLKVRPRKGSMLVWENL---- 449
            .|          |.|.....::...|:| |::|..||..|||..::||...:|.:|.|.||    
  Fly   387 PYTNYYDFFKKRNSESKGFGDRMATFMFYLNDAPYGGATVFPRLNVKVPAERGKVLFWYNLNGDT 451

  Fly   450 ---KKSLIYHQCPILKGNMWV 467
               :.:.::..||:..|:.||
  Fly   452 HDMEPTTMHAACPVFHGSKWV 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4174NP_001034031.2 P4Ha_N 33..157 CDD:285528 29/127 (23%)
TPR repeat 169..197 CDD:276809 6/27 (22%)
TPR repeat 202..245 CDD:276809 12/46 (26%)
2OG-FeII_Oxy <362..470 CDD:304390 32/125 (26%)
PH4alphaNE3NP_651814.1 P4Ha_N 25..149 CDD:285528 29/123 (24%)
P4Hc 316..478 CDD:214780 40/157 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461877
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28396
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.