DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4174 and CG31016

DIOPT Version :9

Sequence 1:NP_001034031.2 Gene:CG4174 / 40023 FlyBaseID:FBgn0036793 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001263119.1 Gene:CG31016 / 326113 FlyBaseID:FBgn0051016 Length:536 Species:Drosophila melanogaster


Alignment Length:519 Identity:134/519 - (25%)
Similarity:212/519 - (40%) Gaps:105/519 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ESY----DFAISSESQLSLLKLKETHVNNLQSY-----------KKVLKKHLQKIRRAIRQSEEL 74
            |.|    ::.||.|.::.||:.....:..|.||           |:::|:..|.:.:|..:.||.
  Fly    20 EGYRDRQNYVISVEEKMDLLEKDRELIIVLDSYATELNEKIIMLKRIVKEFKQPLEKAKNREEEY 84

  Fly    75 LKSTKTSPRNLIYGYKVLRHLHNDWPQYFRLLKKDLGLEQIAVSQMLLTQQPTSVDFEESMGAMH 139
            |.       |.|....::|.:|.||.:..:||||.:|.|:||:.:.:....|...|..|:..||.
  Fly    85 LS-------NPIDSLSLMRQMHEDWEKVEKLLKKPVGQEKIALVEKMREDLPVENDLMEANQAMF 142

  Fly   140 RLQTVYNLDSYAMTEGFIDDKDKNIRNWSADECLMLGLMYLFLKDYNQSENWLELA--------- 195
            |:...|:|:...::.|:||..... ...||.:|..:|........|..:..||..|         
  Fly   143 RILHTYDLEPKDVSAGWIDGVQYG-GKMSASDCFTMGTFSFMAGSYQIASKWLSAAKDLLVDQPR 206

  Fly   196 LYHYDDNVSPEVLKIKLWNYPNLL-ESLVEANKGLGHYFEAKKYANELLSINPNHTYMLTQLPK- 258
            .||       ||:.|...:...|| .||:.:..        ...|.::|.    ..:|..:... 
  Fly   207 KYH-------EVMGITKADVTLLLARSLIASGN--------VSIATDMLM----RDFMFGEAGSA 252

  Fly   259 -LKHLQSNPAKLTKPKKVFQLQ--------KEICSKRYRRKSGV-----LVCRY-VDWTPFLKLA 308
             ..|...|     |||....|:        .::|....||:.|.     |.||| ...|||||||
  Fly   253 LTVHFLRN-----KPKPSINLESWESDESFNQLCRSSSRRQMGESKPSRLHCRYNTITTPFLKLA 312

  Fly   309 PLKMEELSMKPYISIFYGFLGQKDIEVLKNVSRP-----KLQRIEHLSGNCSCKIG--------- 359
            |.:|||||:.||:..::..|...:||.||.:.:|     |:.|:|..|........         
  Fly   313 PFRMEELSLDPYVIFYHNVLSDAEIEKLKPMGKPFLERAKVFRVEKGSDEIDPSRSADGAWLPHQ 377

  Fly   360 NLSTSLHDVVRKVNELILGITGFPLKGNQMLEVINYGIAGNYNPEEPKIHNK-----------AN 413
            |:.....:|:.::...|..:||...:....::.:.||..|::.|.....::|           |.
  Fly   378 NIDPDDLEVLNRIGRRIEDMTGLNTRSGSKMQFLKYGFGGHFVPHYDYFNSKTFSLETVGDRIAT 442

  Fly   414 AFIFLSNAGKGGEIVFPSRHLKVRPRKGSMLVWENL-KKSLIYH------QCPILKGNMWVANK 470
            ...:|:|...||..|||..:|.|..:|||.|.|.|: :||..|.      .||::.|...|..:
  Fly   443 VLFYLNNVDHGGATVFPKLNLAVPTQKGSALFWHNIDRKSYDYDTRTFHGACPLISGTKLVMTR 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4174NP_001034031.2 P4Ha_N 33..157 CDD:285528 36/134 (27%)
TPR repeat 169..197 CDD:276809 7/36 (19%)
TPR repeat 202..245 CDD:276809 9/43 (21%)
2OG-FeII_Oxy <362..470 CDD:304390 32/125 (26%)
CG31016NP_001263119.1 P4Ha_N 31..160 CDD:285528 37/135 (27%)
P4Hc 333..508 CDD:214780 42/174 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461910
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28396
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.