DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4174 and CG32201

DIOPT Version :9

Sequence 1:NP_001034031.2 Gene:CG4174 / 40023 FlyBaseID:FBgn0036793 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_730346.2 Gene:CG32201 / 317911 FlyBaseID:FBgn0052201 Length:520 Species:Drosophila melanogaster


Alignment Length:519 Identity:130/519 - (25%)
Similarity:227/519 - (43%) Gaps:85/519 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LGFQVKGEVVSAPESYD----FAISSESQLSLLKLKETHVNNLQSYKKVLKKHLQKIRRAIRQ-S 71
            |||.|....|...|..:    ::.|:...|.|||::|...:||.:....|.:..:.:|..:.. .
  Fly    12 LGFAVLNSFVGCVEDIEEKERYSSSTVGLLKLLKVEEKFTDNLLNQVDQLGEKFEALRMYLSSVG 76

  Fly    72 EELLKSTKTSPR---NLIYGYKVLRHLHNDWPQYFRLLKKDLGLEQIAVSQMLLTQQPTSVDFEE 133
            .||.:|.....:   |.|..:.:||..|.|.|::....|:.:|....::...|:...|..||...
  Fly    77 YELHRSLNEKVQYVSNPINAFSLLRRTHEDLPKWHEYFKEAIGEGNQSILVDLVKMVPNDVDMLS 141

  Fly   134 SMGAMHRLQTVYNLDSYAMTEGFIDDKDKNIRNWSADECLMLGLMYLFLKDYNQSENWLELALYH 198
            :|..:.|::.:|:|....:.:|.:.....|::....|...|...||. ..||..:..|..:|...
  Fly   142 AMHGIQRIEKIYDLKIDDLAQGVLQGVQYNVQLTYRDLIAMGNSMYQ-QSDYQTAAKWYRIACKR 205

  Fly   199 YDDNVSPEVLKIKLWNYPN------LLESLVEANKGLGHYFEAKKYANELLSINPNHTYMLTQLP 257
            ..:|  ||.|.|::...|:      .::||.:......   |..|...|        .:::.|..
  Fly   206 ELEN--PEQLFIQILGDPSEHLHRQYIKSLFKYGSTTS---EPSKSIEE--------AFIMVQAS 257

  Fly   258 KLKHLQSNPAKLTKPKKVFQLQKEI-------------CSKRYRRKSGVLVCRYVDW-TPFLKLA 308
            : :.|.:..:.|.:|:...:::|::             |...||:|:. |||||... ..||:||
  Fly   258 Q-EELDNIMSDLNEPQNDVEVEKDLYQVKRSPSNCELGCRGLYRQKTN-LVCRYKSTANTFLRLA 320

  Fly   309 PLKMEELSMKPYISIFYGFLGQKDIEVLKNVSRPKLQRIEHLSGNCSCKIGNLSTSLHDVV---- 369
            |||:||:|:.|::::::..|...:|..||.      |.:..::|..|.:.|   |.:.|.|    
  Fly   321 PLKLEEISLDPFMAMYHEVLYDSEIRELKG------QSMNMVNGYASQRNG---TEIRDTVVRYD 376

  Fly   370 ---------RKVNELILGITGFPLKGNQMLEVINYGIAGNYNP---------EEPKI----HNKA 412
                     .::|:.|:.:|||....::.|::.|||:...:.|         |.|.|    ...|
  Fly   377 WWSNTSLVRERINQRIIDMTGFNFLKDEKLQIANYGLGTYFQPHFDYSSDGFETPNITTLGDRLA 441

  Fly   413 NAFIFLSNAGKGGEIVFPSRHLKVRPRKGSMLVWENL----KKSL--IYHQCPILKGNMWVANK 470
            :...:.|...:||..|||..::.|.|:|||||.|.||    |..:  ::..||:|.|:.|...|
  Fly   442 SILFYASEVPQGGATVFPEINVTVFPQKGSMLYWFNLHDDGKPDIRSLHSVCPVLNGDRWTLTK 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4174NP_001034031.2 P4Ha_N 33..157 CDD:285528 30/127 (24%)
TPR repeat 169..197 CDD:276809 8/27 (30%)
TPR repeat 202..245 CDD:276809 11/48 (23%)
2OG-FeII_Oxy <362..470 CDD:304390 39/139 (28%)
CG32201NP_730346.2 P4Ha_N 36..165 CDD:285528 31/128 (24%)
P4Hc 341..507 CDD:214780 47/174 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461855
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28396
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.