DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4174 and P4htm

DIOPT Version :9

Sequence 1:NP_001034031.2 Gene:CG4174 / 40023 FlyBaseID:FBgn0036793 Length:473 Species:Drosophila melanogaster
Sequence 2:XP_217285.7 Gene:P4htm / 301008 RGDID:1311848 Length:503 Species:Rattus norvegicus


Alignment Length:494 Identity:89/494 - (18%)
Similarity:167/494 - (33%) Gaps:186/494 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 QQPTSVDFEESMGAMHRLQTVYNLDSYAMTEGFIDDKDKNIRNWSADE--C------LMLGLMYL 180
            |:|.:...||:......|...:.....|...|  |.::..:|......  |      :::..::|
  Rat     9 QRPVAETIEEASNLQWPLPPEHRPSGAATRPG--DGEEAPVRPLCKPRGICSRAYFLVLMVFVHL 71

  Fly   181 FLKDYNQSENWLELALY-HY---DDNVSP---------------------EVLKIKLWNYPNLLE 220
            :|      .|.|.|.|: ||   |::..|                     |.:|:   .|    |
  Rat    72 YL------GNVLALLLFVHYSNGDESTDPGPQRREQSPQPVPTLGPLTRLEGIKV---GY----E 123

  Fly   221 SLVEANKGLGHYFEAKKYANELLSINP-----------NHTYMLTQLPKLKHLQSNPAKLTKPKK 274
            ..|:...|..|:...       ||:.|           ....::..|.::|.||.:....|:..:
  Rat   124 RKVQVVAGRDHFIRT-------LSLKPLLFEIPGFLSDEECRLIIHLAQMKGLQRSQILPTEEYE 181

  Fly   275 ------------VFQLQKEICSKRYRRKSGVLVCRYVD--WTPFLKLAPLKMEE----------- 314
                        :|||..:....|.:.:..:...|..:  |     :.|..::|           
  Rat   182 EAMSAMRVSQLDLFQLLDQNHDGRLQLREVLAQTRLGNGRW-----MTPENIQEMYSAIKADPDG 241

  Fly   315 ---LSMKPYISI----FYGFLGQ---KDIEVLKNVSRPKLQRIEHLSGNCSCKIGNLSTSLHDVV 369
               ||::.:.::    |:.::..   :..|:::|.....|.:.|               ..|.|:
  Rat   242 DGVLSLQEFSNMDLRDFHKYMRSHKAESSELVRNSHHTWLHQGE---------------GAHHVM 291

  Fly   370 RKVNELILGITGFP---LKGNQMLEVINYGIAGNYN---------PEEPKIHNK--AN------- 413
            |.:.:.:|.:|...   ::.::.|:|:.||..|:|:         ||....|.|  ||       
  Rat   292 RAIRQRVLRLTRLSPEIVELSEPLQVVRYGEGGHYHAHVDSGPVYPETVCSHTKLVANESVPFET 356

  Fly   414 ------AFIFLSNAGKGGEIVFP----------------------SRH-----LKVRPRKGSMLV 445
                  ...:|:|...|||.|||                      .||     |:|:|::|:.:.
  Rat   357 SCRYMTVLFYLNNVTGGGETVFPVADNRTYDEMSLIQDNVDLRDTRRHCDKGNLRVKPQQGTAVF 421

  Fly   446 WEN-----------LKKSLIYHQCPILKGNMWVANKVLN 473
            |.|           :....::..|.:.:|..|:||..:|
  Rat   422 WYNYLPDGQGWVGEVDDYSLHGGCLVTRGTKWIANNWIN 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4174NP_001034031.2 P4Ha_N 33..157 CDD:285528 7/32 (22%)
TPR repeat 169..197 CDD:276809 6/35 (17%)
TPR repeat 202..245 CDD:276809 9/63 (14%)
2OG-FeII_Oxy <362..470 CDD:304390 37/172 (22%)
P4htmXP_217285.7 EF-hand_7 193..253 CDD:404394 10/64 (16%)
P4Hc 247..459 CDD:214780 43/226 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343198
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.