DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4174 and P4HA3

DIOPT Version :9

Sequence 1:NP_001034031.2 Gene:CG4174 / 40023 FlyBaseID:FBgn0036793 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001275677.1 Gene:P4HA3 / 283208 HGNCID:30135 Length:604 Species:Homo sapiens


Alignment Length:543 Identity:125/543 - (23%)
Similarity:210/543 - (38%) Gaps:159/543 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KGEVVSAPESYDFAISSESQL-----SLLKLKETHVNNL-QSYKKVLKKHLQKIRRAIRQSEELL 75
            :|:..||..|...|::.|.:|     ..|:.:|..:.:| :.|.|||..|               
Human    27 RGDTFSALTSVARALAPERRLLGLLRRYLRGEEARLRDLTRFYDKVLSLH--------------- 76

  Fly    76 KSTKTSPRNLIYGYKVLRHLHNDWPQYFRLLK--------KDLGLEQIAVSQMLLTQQPTSVDFE 132
            :.:.|...|.:..:.:::.|.:||......|:        || |.|:  |.|.|    |...|.|
Human    77 EDSTTPVANPLLAFTLIKRLQSDWRNVVHSLEASENIRALKD-GYEK--VEQDL----PAFEDLE 134

  Fly   133 ESMGAMHRLQTVYNLDSYAMTEGF--------IDD--KDKNIRNWSADECLMLGLMYLFLKDYNQ 187
            .:..|:.|||.||.|:...:..|.        |.|  ..|.:.:.:.|:|..:|.:...:.||..
Human   135 GAARALMRLQDVYMLNVKGLARGVFQRVTGSAITDLYSPKRLFSLTGDDCFQVGKVAYDMGDYYH 199

  Fly   188 SENWLELAL---------YHYDDNVSPEVLKIKLWNYPNLLESLVEANKGLGHYFEA-------- 235
            :..|||.|:         :..:|..|.|          :.|:.|..|      ||.|        
Human   200 AIPWLEEAVSLFRGSYGEWKTEDEASLE----------DALDHLAFA------YFRAGNVSCALS 248

  Fly   236 ------------KKYA------NELLSINPNHTY--MLTQLPKLKHLQSNPA------KLTKPKK 274
                        |:.|      ..||:.:|||..  .:.|.|.:.|||:...      .|.....
Human   249 LSREFLLYSPDNKRMARNVLKYERLLAESPNHVVAEAVIQRPNIPHLQTRDTYEGLCQTLGSQPT 313

  Fly   275 VFQLQKEICSKRYRRKSGVLVCRYVDWTPFLKLAPLKMEELSMKPYISIFYGFLGQKDIEVLKNV 339
            ::|:....||  |...|..          :|.|.|::.|.:.::|||::::.|:...:.:.::.:
Human   314 LYQIPSLYCS--YETNSNA----------YLLLQPIRKEVIHLEPYIALYHDFVSDSEAQKIREL 366

  Fly   340 SRPKLQRIEHLSGNCSCKIG---NLSTSLHDVVR----KVNELILGITGFPLKG--NQMLEVINY 395
            :.|.|||....||....::.   :.|..|.|.|.    .:|..|..:||..::.  .:.|:|:||
Human   367 AEPWLQRSVVASGEKQLQVEYRISKSAWLKDTVDPKLVTLNHRIAALTGLDVRPPYAEYLQVVNY 431

  Fly   396 GIAGNY--------NPEEP----KIHNKANAF-IFLSNAGKGGEIVFPSRHLKVRPRKGSMLVWE 447
            ||.|:|        :|..|    |..|:...| |:||:...||...|               ::.
Human   432 GIGGHYEPHFDHATSPSSPLYRMKSGNRVATFMIYLSSVEAGGATAF---------------IYA 481

  Fly   448 NLKKSLIYH----QCP-ILKGNM 465
            ||...::.|    .|. ::||.:
Human   482 NLSVPVVRHCFGGTCTGVVKGTV 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4174NP_001034031.2 P4Ha_N 33..157 CDD:285528 34/145 (23%)
TPR repeat 169..197 CDD:276809 9/36 (25%)
TPR repeat 202..245 CDD:276809 12/68 (18%)
2OG-FeII_Oxy <362..470 CDD:304390 33/128 (26%)
P4HA3NP_001275677.1 P4Ha_N 58..159 CDD:285528 31/122 (25%)
TPR_12 186..252 CDD:290160 16/81 (20%)
P4Hc 356..>478 CDD:214780 32/121 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149295
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.