DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4174 and p4ha1

DIOPT Version :9

Sequence 1:NP_001034031.2 Gene:CG4174 / 40023 FlyBaseID:FBgn0036793 Length:473 Species:Drosophila melanogaster
Sequence 2:XP_031761963.1 Gene:p4ha1 / 100490484 XenbaseID:XB-GENE-987760 Length:526 Species:Xenopus tropicalis


Alignment Length:509 Identity:132/509 - (25%)
Similarity:222/509 - (43%) Gaps:86/509 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DFAISSESQLSLLKLKETHVNNLQSYKKVLKKHLQKIRRAIRQSEELLKSTKTSPRNL----IYG 88
            ||..|....:.||..::..|.:|:.|.|..::.|.:|::...:.:.|..:....|...    :..
 Frog    19 DFFTSIGHMIDLLNTEKDLVTSLKDYIKAEEQKLAQIKKWADKLDHLTDTATKDPEGYLGHPVNA 83

  Fly    89 YKVLRHLHNDWPQYFRLLKKDL--GLEQIAVSQMLLTQQ--PTSVDFEESMGAMHRLQTVYNLDS 149
            :|:::.|:.:|.:...|:.||:  |.    :|.:.:.:|  |...|...:..|:.|||..||||:
 Frog    84 FKLMKRLNTEWVKLENLILKDISDGF----ISNLTIQRQYFPNDEDQTGAAKALLRLQDTYNLDT 144

  Fly   150 YAMTEGFIDDKDKNIRNWSADECLMLGLMYLFLKDYNQSENWLELALYHYDDNVSPEVLKIKLWN 214
            ..:::|.:... |:..:.:|::|..||.......||..:|.|:|.||...|......:.|:.:.:
 Frog   145 DTISKGNLPGV-KHKTSLTAEDCFDLGKTAYTDADYYHTELWMEQALSQLDAGEESSLDKVMVLD 208

  Fly   215 YPNLLESLVEANKGLGHYFEAKKYANELLSINPNHTYMLTQLPKLKHLQSNPAKLT--------- 270
            |      |..|....|...:|.......|.::|.|......|..:...:||.:..:         
 Frog   209 Y------LSYAVYQQGDLDKALTLTKRSLELDPEHQRGNGNLRHIMSKESNKSSSSPSEGAELRT 267

  Fly   271 ---KPKKVFQLQK--EIC--------SKRYRRKSGVLVCRYVDW--TPFLKLAPLKMEELSMKPY 320
               :||...:.:|  ::|        |:|.:|    |.|||.|.  .|.|.|:|.|.|:...||.
 Frog   268 RKGRPKDHLEKEKYEKLCRGEGVKMTSRRQKR----LFCRYFDGKKDPLLILSPTKQEDEWDKPR 328

  Fly   321 ISIFYGFLGQKDIEVLKNVSRPKLQRIEHLSGNCSCKI-GNLSTSLH-------------DVVRK 371
            |..::..:..::|..:|.:::|:|:|     ...|..| |.|.|:.:             .||.:
 Frog   329 IVRYHDIISDEEISKVKELAKPRLRR-----ATISNPITGVLETAQYRITKSAWLSGYEDPVVAR 388

  Fly   372 VNELILGITGFPLKGNQMLEVINYGIAGNYNPE-------EPKIHNK-------ANAFIFLSNAG 422
            :|..|.|:||..:...:.|:|.||||.|.|.|.       ||....|       |....::|:..
 Frog   389 LNRRIEGVTGLDMSTAEELQVANYGIGGQYEPHFDFLRKYEPDAFKKLGTGNRVATWLFYMSDVE 453

  Fly   423 KGGEIVFPSRHLKVRPRKGSMLVWENLKK------SLIYHQCPILKGNMWVANK 470
            .||..|||.....|.|:||:.:.|.||.:      |..:..||:|.||.||:||
 Frog   454 AGGATVFPEVGAAVYPKKGTAVFWYNLLESGEGDYSTRHAACPVLVGNKWVSNK 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4174NP_001034031.2 P4Ha_N 33..157 CDD:285528 30/131 (23%)
TPR repeat 169..197 CDD:276809 10/27 (37%)
TPR repeat 202..245 CDD:276809 7/42 (17%)
2OG-FeII_Oxy <362..470 CDD:304390 42/140 (30%)
p4ha1XP_031761963.1 P4Ha_N 24..111 CDD:400573 17/90 (19%)
P4Hc 337..510 CDD:214780 53/176 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.