DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R1 and TrissinR

DIOPT Version :9

Sequence 1:NP_649040.2 Gene:AstC-R1 / 40020 FlyBaseID:FBgn0036790 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001097092.1 Gene:TrissinR / 33812 FlyBaseID:FBgn0085410 Length:669 Species:Drosophila melanogaster


Alignment Length:548 Identity:120/548 - (21%)
Similarity:187/548 - (34%) Gaps:190/548 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WLMMDVLQFVKGEMTADSEANAT-------NWYNTNESLY----TTELNHRWISGSS------TI 51
            |..:.:|..:....|..:.||.|       |..:|:..|.    ||.|.....:|.|      .|
  Fly   100 WKTLLILLTLLSASTLTASANVTSTISPPINGSSTDYILLYGESTTSLVPALTTGLSGDGSGAVI 164

  Fly    52 QPEESLYGTDLPTYQHCIATRNSFADLFTVVLYGFVCIIGLFGNTLVIYVVLRFSKMQTVTNIYI 116
            :.||     |.......|..|.....:| :.||..|.....|||.|||.||....:::::||.::
  Fly   165 EDEE-----DAEKASEYIFDRTDVRIIF-ITLYTLVFCCCFFGNLLVILVVTLSRRLRSITNFFL 223

  Fly   117 LNLAVADECFLIGIPFLLYTMRIC---SWRFGEFMCKAYMVSTSITSFTSSIFLL-IMSADRYIA 177
            .|||.||.|  :|:..::..:.|.   ||.||||:|:.|....|: |:|:|||:| ::..:||.|
  Fly   224 ANLAFADFC--VGLFCVMQNLSIYLIESWVFGEFLCRMYQFVHSL-SYTASIFILVVICMERYFA 285

  Fly   178 VCHPISSPRYRTLHIAKVVSAIAWSTSAVLMLPVILYASTVEQ---EDGINYSCNIMWPDAYKKH 239
            :.|||:..:..|....::|....|.||||...|..:::.|::.   :||......::..:.:   
  Fly   286 IVHPITCKQILTAARLRMVIVTVWITSAVYSTPKFVFSKTIKNIHTQDGQEEEICVLDREMF--- 347

  Fly   240 SGTTFILYTFFLGFATPLCFILSFYYLVI------------------------------------ 268
            :.....:..|.|.:..||..:...|..:.                                    
  Fly   348 NSKLLDMINFVLLYVMPLLVMTVLYSKIAIALWRSSRGLTPHVVQHQHQQPQQPSCQDIGMGMHN 412

  Fly   269 ----------------RKLRSV-----------------GPKPGTKS---------------KEK 285
                            .:|:|.                 ||.|...|               .||
  Fly   413 SMYHHHPHHHHHHHQHHQLQSAASSAGVVGVGLGGGGGGGPGPSLASGGSSTTSLSRKQSSKYEK 477

  Fly   286 R---------------------------------------------------------------- 286
            |                                                                
  Fly   478 RGVSITESQLDNCKVSLEADRPIVSACRKTSFYHHGHAHHQRAGNASVGGGSGGAGAGATHMSHS 542

  Fly   287 -----RAHRKVTRLVLTVISVYILCWLPHWISQVALIHSNPAQRDLSRLEILIFLLLGALVYSNS 346
                 ||.|.|.|:::..:..:.||.||:...::....|...:.| |....|:..|...:.|.||
  Fly   543 SSNVLRARRGVVRMLIIFVLTFALCNLPYHARKMWQYWSRSYRGD-SNFNALLTPLTFLVTYFNS 606

  Fly   347 AVNPILYAFLSENFRKSFFKAFTCMNKQ 374
            .|||:||||||.||||...:...|..|:
  Fly   607 GVNPLLYAFLSRNFRKGMKELLLCSWKK 634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R1NP_649040.2 7tm_4 88..368 CDD:304433 94/439 (21%)
7tm_1 94..353 CDD:278431 83/418 (20%)
TrissinRNP_001097092.1 7tm_4 191..>327 CDD:304433 50/138 (36%)
7tm_1 201..>385 CDD:278431 54/189 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3389
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.