DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and si:dkey-42l23.2

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:XP_005173460.1 Gene:si:dkey-42l23.2 / 795679 ZFINID:ZDB-GENE-131121-582 Length:343 Species:Danio rerio


Alignment Length:357 Identity:98/357 - (27%)
Similarity:164/357 - (45%) Gaps:50/357 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 ITMILYALVCIIGLFGNTLVIYVVMRFSKMQTVTNIYILNLAIADECFLIGIPFLLYTM---QVG 208
            ||.:::|    :|:.||.|||||. .:....||.:|:.|||||||..|::.:...::|:   :| 
Zfish    26 ITTVIFA----VGIIGNALVIYVT-GYKMKTTVNSIWFLNLAIADFIFILFLILTIFTLINKRV- 84

  Fly   209 NWPFGNYMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTPFVSKLVSAFAWMTSV 273
             |.||::|||.....:.:..|.|...|..:|.||.::....:.:...||.|..:::.||.|:.|:
Zfish    85 -WYFGDFMCKLASFVSVLNMFASIFLLTAISLDRCMSTWWIVWAQNKRTLFKGRIICAFVWVLSI 148

  Fly   274 LLMLPVILFASTVQSSNGNVSCNIEWPDTQNSHTDSTFIL-YSLVLGFATPLTFILVFYCLVIRK 337
            ...:|.:     :..|..|.:|.      .|..|:..|:. |..::||..|...|...|.     
Zfish   149 CCSIPFV-----ICRSGENKTCK------YNPGTNINFLFTYRFIVGFLIPFLVIASSYI----- 197

  Fly   338 LHTVGPKHKSKEKKRSHR-KVTKLVLTVISAYIFCWLPHWISQV--ALISSAPQRCASR---LEL 396
              .:|.  ::|..||..: |..:::|:||.|:..||||..:.|:  |:.....:....|   ..:
Zfish   198 --AIGV--RAKRLKRGKKLKPFRVILSVILAFFICWLPFHLQQLITAMTKGKDEWSGIRKVLYNI 258

  Fly   397 AVFLACGCLSYSNSAMNPILYAFLSDNFKKSFMKACTCAARKDVNAQLQLENSFFPKFG-KGRQS 460
            ..|:  |.|:|.||.:|||||.|:.:.|||...::..          |.||.:|..... :.|||
Zfish   259 GPFV--GSLAYFNSCLNPILYVFMCEEFKKKLKQSLL----------LVLETAFAEDLPFRTRQS 311

  Fly   461 ERLLGGNGKGGAQRGALTKKKCLATRNNNAPM 492
            ........:|..|....|.....::::|...:
Zfish   312 TCSAFSESQGLQQPNDATFSSSASSQDNKTTL 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 62/220 (28%)
7tm_1 162..417 CDD:278431 77/264 (29%)
si:dkey-42l23.2XP_005173460.1 7tm_1 37..277 CDD:278431 77/264 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.