DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and lpar4

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001072847.1 Gene:lpar4 / 780308 XenbaseID:XB-GENE-989373 Length:350 Species:Xenopus tropicalis


Alignment Length:323 Identity:88/323 - (27%)
Similarity:154/323 - (47%) Gaps:29/323 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 DCSYSYNFILKLITMILYALVCIIGLFGNTLVIYVVMRFSKMQTVTNIYILNLAIADECFLIGIP 199
            |.|:.||     :...:|::|.|.||..|...::|.....:||..|.|::.|||::|..|:..:|
 Frog    13 DDSFKYN-----LYGAVYSVVFIFGLITNCASLFVFCFKMRMQNETAIFMTNLAVSDLLFVFTLP 72

  Fly   200 FLLYTMQVGNWPFGNYMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTPFVSKLV 264
            |.::.....:||||:.:||....:.....:.|.:||..:|.||::|:.:|..|...||...|.:|
 Frog    73 FKIFYNFNRHWPFGDSLCKISGTAFLTNIYGSMLFLTCISVDRFLAIVYPFRSRTIRTRKNSAIV 137

  Fly   265 SAFAWMTSVLLMLPVILFASTVQSSNGNVSCNIEWPDTQNSHTDSTFILYSLVLGFATPLTFILV 329
            .|..|:..:...:...|| ||...||.:.:|...:..:......|...::..|:||..||...|.
 Frog   138 CACVWIIVLSGGISASLF-STTNVSNTSTTCFEGFSKSIWKTYLSKITIFIEVVGFIIPLLLNLT 201

  Fly   330 FYCLVIRKLH---TVGPKHKSKEKKRSHRKVTKLVLTVISAYIFCWLP--HWISQVALI-SSAPQ 388
            ...||:|.|.   |:.....:||      ||.|:::..::.::.|::|  ..:...||: |.|..
 Frog   202 CSSLVLRTLRKPATLCQIGTNKE------KVLKMIVVHVAIFVVCFVPFNSILFLYALVRSQAIS 260

  Fly   389 RCA-SRLELAVFLACGCLSYSNSAMNPILYAFLSDNFKKSFMKACTCAARKDVNAQLQLENSF 450
            .|| .|....::....|::..|...:|.:|.|.|.:|:|||          ::|..::::..|
 Frog   261 NCAVERFARTMYPITLCIATMNCCFDPFVYYFTSKSFQKSF----------NINPIIKMDTLF 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 61/218 (28%)
7tm_1 162..417 CDD:278431 70/261 (27%)
lpar4NP_001072847.1 7tm_4 30..>144 CDD:304433 37/113 (33%)
7tm_1 36..290 CDD:278431 70/260 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X22
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.