DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and P2ry13

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_083084.2 Gene:P2ry13 / 74191 MGIID:1921441 Length:337 Species:Mus musculus


Alignment Length:324 Identity:72/324 - (22%)
Similarity:146/324 - (45%) Gaps:37/324 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 KLITMILYALVCIIGLFGNTLVIYVVMRFSKMQTVTNIYILNLAIADECFLIGIPF-LLYTMQVG 208
            :|:..:||.:|.:.|:..||:.::|.:......|.. :|:.|..:||....:.:|| :|....:.
Mouse    27 QLLFPVLYTVVFLAGILLNTVALWVFVHIPSNSTFI-VYLKNTLVADLIMALMLPFKILSDSHLA 90

  Fly   209 NWPFGNYMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTPFV-----SKLVSAFA 268
            .|....::|....|....|.:...:.|.:::.||::.:..|     :|..||     :|.||...
Mouse    91 PWQLRGFVCTLSSVVFYETMYVGIMMLGLIAFDRFLKIIMP-----FRKTFVKKTAFAKTVSISV 150

  Fly   269 WMTSVLLMLPVILFASTVQSSNGNVSCNIE-----WPDTQNSHTDSTFILYSLVLGFATPLTFIL 328
            |.....:.||.::.......|:.....:::     |.....||| ..||.:::.:       .:|
Mouse   151 WSLMFFISLPNMILNKEATPSSVKKCASLKSPLGLWWHQVVSHT-CQFIFWAVFI-------LML 207

  Fly   329 VFYCLVIRKLHTVGPKHKSKEKKRSHRKVTKLVLTVISAYIFCWLP-HWISQVALISSAPQRCAS 392
            :||.::.:|::....|.:||:.:  |:::...|..|::.:..|:.| |::......|....:...
Mouse   208 LFYAVITKKVYNSYRKFRSKDSR--HKRLEVKVFIVMAVFFVCFAPLHFVRIPYTYSQTTNKTDC 270

  Fly   393 RLELAVFLACGC---LSYSNSAMNPILYAFLSDNFKKS-----FMKACTCAARKDVNAQLQLEN 448
            |||..:|:|...   |:.:|..|:|::|..|...|.:.     :.||.|..:.:|.::. |.:|
Mouse   271 RLENQLFIAKEATLFLATTNICMDPLIYIILCKKFTQKVPCVRWGKARTAGSSEDHHSS-QTDN 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 46/226 (20%)
7tm_1 162..417 CDD:278431 58/269 (22%)
P2ry13NP_083084.2 7tm_1 45..298 CDD:278431 58/268 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.