DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and P2ry12

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001343936.1 Gene:P2ry12 / 70839 MGIID:1918089 Length:347 Species:Mus musculus


Alignment Length:325 Identity:68/325 - (20%)
Similarity:137/325 - (42%) Gaps:50/325 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 CSYSYNFILKLITMILYALVCIIGLFGNTLVIYVVMRFSKMQTVTN--IYILNLAIADECFLIGI 198
            |...|. |.:::..:||.::...||..|:|.:.:   |.::::.:|  |::.|..|:|...::..
Mouse    23 CVRDYK-ITQVLFPLLYTVLFFAGLITNSLAMRI---FFQIRSKSNFIIFLKNTVISDLLMILTF 83

  Fly   199 PF-LLYTMQVGNWPFGNYMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTPFVSK 262
            || :|...::|..|....:|:...|:...|.:.|..||.:::.|||:....|..:........:|
Mouse    84 PFKILSDAKLGAGPLRTLVCQVTSVTFYFTMYISISFLGLITIDRYLKTTRPFKTSSPSNLLGAK 148

  Fly   263 LVSAFAWMTSVLLMLPVILFASTVQSSNGNVSCN-------IEWPDTQNSHTDSTFILYSLVLGF 320
            ::|...|....|:.||.::..:..........|:       :.|.:..|......|.:..|:   
Mouse   149 ILSVVIWAFMFLISLPNMILTNRRPKDKDVTKCSFLKSEFGLVWHEIVNYICQVIFWINFLI--- 210

  Fly   321 ATPLTFILVFYCLVIRKLHT--VGPKHKSKEKKRSHRKVTKLVLTVISAYIFCWLPHWISQVALI 383
                  ::|.|.|:.::|:.  |..:..:|..|   :||...|..:|:.:..|::|...:::...
Mouse   211 ------VIVCYSLITKELYRSYVRTRGSAKVPK---KKVNVKVFIIIAVFFICFVPFHFARIPYT 266

  Fly   384 SSAPQRCASRLELAVFLACGC-------------LSYSNSAMNPILYAFLSDNFKKSFMKACTCA 435
            .|..:        ||| .|..             |:..|:.::|.:|.||..:|:.|......|:
Mouse   267 LSQTR--------AVF-DCSAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLTSMLRCS 322

  Fly   436  435
            Mouse   323  322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 47/227 (21%)
7tm_1 162..417 CDD:278431 55/279 (20%)
P2ry12NP_001343936.1 7tmA_P2Y12 32..315 CDD:341326 63/306 (21%)
TM helix 1 34..58 CDD:341326 7/26 (27%)
TM helix 2 66..87 CDD:341326 6/20 (30%)
TM helix 3 104..126 CDD:341326 5/21 (24%)
TM helix 4 149..165 CDD:341326 4/15 (27%)
TM helix 5 193..216 CDD:341326 4/31 (13%)
TM helix 6 241..263 CDD:341326 4/21 (19%)
TM helix 7 283..308 CDD:341326 5/24 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 321..347 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.