DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and Fpr-rs4

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:XP_002728738.1 Gene:Fpr-rs4 / 690198 RGDID:1310130 Length:323 Species:Rattus norvegicus


Alignment Length:336 Identity:95/336 - (28%)
Similarity:166/336 - (49%) Gaps:38/336 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 QNGSHYLEYDDDGPDCSYSYNFILKLITMILYALVCIIGLFGNTLVIYVVMRFSKMQTVTNIYIL 185
            :|||....||.       :.:.:|.::::::..:..::|:.||.|||: |..|....|||.:..|
  Rat     9 RNGSEVGFYDS-------TTSTVLWILSLVVLCITFVLGVLGNGLVIW-VSEFRMAHTVTTVCYL 65

  Fly   186 NLAIADECFLIGIPFLLYTMQV-GNWPFGNYMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHP 249
            |||::|..|:..:|..:.:|.: |.|.||.::||...:..:|..|.|...:.:::.||...|.||
  Rat    66 NLALSDFSFMATLPLQIISMVMRGKWLFGWFLCKLVHIIANINLFVSIFLITLIAMDRCTCVLHP 130

  Fly   250 ISSPRYRTPFVSKLVSAFAWMTSVLLMLPVILFASTVQSSNGNVSCNIE---W---PDTQ----- 303
            :.|..:||..:::.|...||:.::||.||..||.:||:.:.|.|.|..:   |   |:.|     
  Rat   131 VWSQNHRTVSLARKVVVGAWIFALLLTLPHFLFLTTVKDARGEVHCISKFESWVATPEEQLKVSI 195

  Fly   304 NSHTDSTFILYSLVLGFATPLTFILVFYCLVIRKLHTVGPKHKSKEKKRSHRKVTKLVLTVISAY 368
            .:.|.|..|  :.::||:.|::||.:.|.|:..|:...|....|:..:         |||.::..
  Rat   196 TATTASGII--NFIIGFSMPMSFIAICYGLMAVKICRRGFVKSSRPLR---------VLTAVAVS 249

  Fly   369 IF-CWLPHWISQVALISSAPQRCASRLELAVFLACGCLSYSNSAMNPILYAFLSDNFKKSFMKAC 432
            .| ||.|..:  :.|:.:...:....:...:......|:..||.:|||||.||...|:...|.:.
  Rat   250 FFVCWFPFQL--IMLLGNILNKETLSIIHILVNPANTLASFNSCLNPILYVFLGQEFRDRLMHSL 312

  Fly   433 TC----AARKD 439
            :.    |.|:|
  Rat   313 SASLERALRED 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 70/228 (31%)
7tm_1 162..417 CDD:278431 79/267 (30%)
Fpr-rs4XP_002728738.1 7tm_1 43..297 CDD:278431 79/267 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.