DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and Lpar6

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_780325.1 Gene:Lpar6 / 67168 MGIID:1914418 Length:344 Species:Mus musculus


Alignment Length:347 Identity:89/347 - (25%)
Similarity:157/347 - (45%) Gaps:40/347 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 DGPDCSYSYNFILKLITMILYALVCIIGLFGNTLVIYVVMRFSKMQTVTNIYILNLAIADECFLI 196
            :|..|.|..:|...|.. .::::|.::||..|.:.||:.:...|::..|..|::|||::|..|:.
Mouse     5 NGSQCPYDDSFKYTLYG-CMFSMVFVLGLISNCVAIYIFICALKVRNETTTYMINLAMSDLLFVF 68

  Fly   197 GIPFLLYTMQVGNWPFGNYMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTPFVS 261
            .:||.::.....|||||:.:||..::......:.|.:||..:|.||::|:.:|..|...||...:
Mouse    69 TLPFRIFYFATRNWPFGDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVYPFKSKTLRTKRNA 133

  Fly   262 KLVSAFAWMTSVLLMLPVILFAST-VQSSNGNVSCNIEWPDTQNSHTDSTFILYSLVLGFATPLT 325
            |:|....|.|.:....|.:.|.|| .|.:|.:.:|...:|........|..:::..::||..||.
Mouse   134 KIVCIAVWFTVMGGSAPAVFFQSTHSQGNNTSEACFENFPAATWKTYLSRIVIFIEIVGFFIPLI 198

  Fly   326 FILVFYCLVIRKLHTVGPKHKSKEKKRSHRKVTKLVLTVISAYIFCWLPHWISQVALISSAPQRC 390
            ..:....:|:|.|:......:||..|   .||.|::...:..:.||::|:.|:.:..        
Mouse   199 LNVTCSSMVLRTLNKPVTLSRSKMNK---TKVLKMIFVHLVIFCFCFVPYNINLILY-------- 252

  Fly   391 ASRLELAVFLACG-------------CLSYSNSAMNPILYAFLSDNFKKSFMKACTCAARKD--- 439
             |.:....|:.|.             |::.||...:||:|.|.||..:.|.........|.|   
Mouse   253 -SLMRTQTFVNCSVVAAVRTMYPITLCIAVSNCCFDPIVYYFTSDTIQNSIKMKNWSVRRSDSRF 316

  Fly   440 ---------VNAQLQ-LENSFF 451
                     :...|| |:|..|
Mouse   317 SEVQGTENFIQHNLQTLKNKIF 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 60/216 (28%)
7tm_1 162..417 CDD:278431 69/268 (26%)
Lpar6NP_780325.1 7tm_4 29..>142 CDD:304433 35/112 (31%)
7tm_1 35..291 CDD:278431 69/267 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X22
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.