DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and Ptafr

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_445773.1 Gene:Ptafr / 58949 RGDID:61897 Length:341 Species:Rattus norvegicus


Alignment Length:333 Identity:80/333 - (24%)
Similarity:151/333 - (45%) Gaps:59/333 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 QQNGSHYLEYDDDGPDCSYSYNFILKLITMILYALVCIIGLFGNTLVIYVVMRF--SKMQTVTNI 182
            :||||..:       |..:.|.     :..|:|:::.::|:..|..|::|....  ||......|
  Rat     2 EQNGSFRV-------DSEFRYT-----LFPIVYSVIFVLGVVANGYVLWVFATLYPSKKLNEIKI 54

  Fly   183 YILNLAIADECFLIGIP-FLLYTMQVGNWPFGNYMCKAYMVSTSITSFTSSIFLLIMSADRYIAV 246
            :::||.:||..||:.:| :::|....|:|....::|........|.::.|..||.:::.:||.||
  Rat    55 FMVNLTVADLLFLMTLPLWIVYYSNEGDWIVHKFLCNLAGCLFFINTYCSVAFLGVITYNRYQAV 119

  Fly   247 CHPISSPRYRTPFVSKLVSAFAWMTSVLLMLPVILFAST----VQSSNGNVSCNIEWPDTQNSHT 307
            .:||.:.:..|......:|...|::........:...||    .:..:||::...|       |.
  Rat   120 AYPIKTAQATTRKRGITLSLVIWISIAATASYFLATDSTNVVPKKDGSGNITRCFE-------HY 177

  Fly   308 DSTFILYSLVLGFATP---LTFILVFYC-LVIRKLHTVGPKH-KSKEKKRSHRKVTKLVLTVISA 367
            :...:...:|..|.|.   |.|.|:||| :||  :||:..:. :.:.|....|:...:|.||::.
  Rat   178 EPYSVPILVVHIFITSCFFLVFFLIFYCNMVI--IHTLLTRPVRQQRKPEVKRRALWMVCTVLAV 240

  Fly   368 YIFCWLPHWISQV--------------ALISSAPQRCASRLELAVFLACGCLSYSNSAMNPILYA 418
            ::.|::||.:.|:              ..|:.|.|         :.|   ||..:|..::|::|.
  Rat   241 FVICFVPHHVVQLPWTLAELGYQTNFHQAINDAHQ---------ITL---CLLSTNCVLDPVIYC 293

  Fly   419 FLSDNFKK 426
            ||:..|:|
  Rat   294 FLTKKFRK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 55/227 (24%)
7tm_1 162..417 CDD:278431 66/280 (24%)
PtafrNP_445773.1 7tm_1 33..292 CDD:278431 66/279 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.