DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and Cysltr1

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001268788.1 Gene:Cysltr1 / 58861 MGIID:1926218 Length:352 Species:Mus musculus


Alignment Length:350 Identity:88/350 - (25%)
Similarity:167/350 - (47%) Gaps:41/350 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 LESVESESYPSINGTQNETMVTSVRPHLDHRNRPTQQNGSHYLEYDDDGPDCSYSYNFILKLITM 149
            |:..:.....::|||:|  :.||:..:..|             :..|:..:..||          
Mouse     3 LQGTKQTFLENMNGTEN--LTTSLINNTCH-------------DTIDEFRNQVYS---------- 42

  Fly   150 ILYALVCIIGLFGNTLVIYVVMRFSKMQTVTNIYILNLAIADECFLIGIPF-LLYTMQVGNWPFG 213
            .:|:::.::|.|||:.|:||:::....::...:|::||||||...:..:|. ::|.:..|.|.||
Mouse    43 TMYSVISVVGFFGNSFVLYVLIKTYHEKSAFQVYMINLAIADLLCVCTLPLRVVYYVHKGKWLFG 107

  Fly   214 NYMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTPFVSKLVSAFAWMTSVLLMLP 278
            :::|:....:..:..:.|..|:..||..|.:|:..|:.:....|...::.|....|:..:|...|
Mouse   108 DFLCRLTTYALYVNLYCSIFFMTAMSFFRCVAIVFPVQNINLVTQKKARFVCIGIWIFVILTSSP 172

  Fly   279 VILFASTVQSSNGNVSCNIEWPDTQNSHTDSTFILY--SLVLGFATPLTFILVFYCLVIRKLHTV 341
            .:::.| .|....|..| .| |...|.......||:  ||..||..|...|:|.|.::|..|   
Mouse   173 FLMYKS-YQDEKNNTKC-FE-PPQNNQAKKYVLILHYVSLFFGFIIPFVTIIVCYTMIILTL--- 231

  Fly   342 GPKHKSKEKKRSHRKVTKLVLTVISAYIFCWLPHWISQ---VALISSAPQRCAS--RLELAVFLA 401
             .|:..|:...|.||...:::.|.:|::..::|:.|.:   :.|:.|..:.|.|  |::.:|.:.
Mouse   232 -LKNTMKKNMPSRRKAIGMIIVVTAAFLVSFMPYHIQRTIHLHLLHSETRPCDSVLRMQKSVVIT 295

  Fly   402 CGCLSYSNSAMNPILYAFLSDNFKK 426
            .. |:.||...:|:||.|...||::
Mouse   296 LS-LAASNCCFDPLLYFFSGGNFRR 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 59/218 (27%)
7tm_1 162..417 CDD:278431 69/262 (26%)
Cysltr1NP_001268788.1 7tm_4 47..264 CDD:304433 59/223 (26%)
7tm_1 55..310 CDD:278431 69/262 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.