DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and PTAFR

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_000943.1 Gene:PTAFR / 5724 HGNCID:9582 Length:342 Species:Homo sapiens


Alignment Length:416 Identity:94/416 - (22%)
Similarity:170/416 - (40%) Gaps:108/416 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 YDDDGPDCSYSYNFILKLITMILYALVCIIGLFGNTLVIYVVMRF--SKMQTVTNIYILNLAIAD 191
            :|....|..:.|.     :..|:|:::.::|:..|..|::|..|.  .|......|:::||.:||
Human     4 HDSSHMDSEFRYT-----LFPIVYSIIFVLGVIANGYVLWVFARLYPCKKFNEIKIFMVNLTMAD 63

  Fly   192 ECFLIGIP-FLLYTMQVGNWPFGNYMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRY 255
            ..|||.:| :::|....|||....::|........|.::.|..||.:::.:|:.||..||.:.:.
Human    64 MLFLITLPLWIVYYQNQGNWILPKFLCNVAGCLFFINTYCSVAFLGVITYNRFQAVTRPIKTAQA 128

  Fly   256 RTPFVSKLVSAFAWM-----TSVLLMLPVILFASTVQSS--NGNVSCNIEWPDTQNSHTDS---T 310
            .|......:|...|:     .|..|:|.   ..:||..|  :|||:...|       |.:.   .
Human   129 NTRKRGISLSLVIWVAIVGAASYFLILD---STNTVPDSAGSGNVTRCFE-------HYEKGSVP 183

  Fly   311 FILYSLVLGFATPLTFILVFYC-LVIRKLHTVGP--KHKSKEKKRSHRKVTKLVLTVISAYIFCW 372
            .::..:.:.|:..|.|:::.:| |||.:...:.|  :.::.|.|   |:...:|.||::.:|.|:
Human   184 VLIIHIFIVFSFFLVFLIILFCNLVIIRTLLMQPVQQQRNAEVK---RRALWMVCTVLAVFIICF 245

  Fly   373 LPHWISQVALISSAPQRCA------SRLELAV---FLACGCLSYSNSAMNPILYAFLSDNFKKSF 428
            :||.:.|:      |...|      |:...|:   .....||..:|..::|::|.||:..|:|..
Human   246 VPHHVVQL------PWTLAELGFQDSKFHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKFRKHL 304

  Fly   429 MKACTCAARKDVNAQLQLENSFFPKFGKGRQSERLLGGNGKGGAQRGALTKKKCLATRNNNAPMA 493
            .:                      ||...|.|                   :||           
Human   305 TE----------------------KFYSMRSS-------------------RKC----------- 317

  Fly   494 TTTTTTTTTTGTDAVTCLQPPVHQVP 519
               :..||.|.|:.|.    |.:|:|
Human   318 ---SRATTDTVTEVVV----PFNQIP 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 58/231 (25%)
7tm_1 162..417 CDD:278431 69/279 (25%)
PTAFRNP_000943.1 7tmA_PAFR 16..304 CDD:320275 77/311 (25%)
TM helix 1 16..43 CDD:320275 6/31 (19%)
TM helix 2 52..77 CDD:320275 9/24 (38%)
TM helix 3 90..120 CDD:320275 7/29 (24%)
TM helix 4 132..154 CDD:320275 3/21 (14%)
TM helix 5 183..212 CDD:320275 7/28 (25%)
TM helix 6 225..255 CDD:320275 11/38 (29%)
TM helix 7 272..297 CDD:320275 6/24 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.