DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and sstr1a

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:XP_696666.1 Gene:sstr1a / 568254 ZFINID:ZDB-GENE-090429-1 Length:366 Species:Danio rerio


Alignment Length:280 Identity:117/280 - (41%)
Similarity:193/280 - (68%) Gaps:7/280 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 LYALVCIIGLFGNTLVIYVVMRFSKMQTVTNIYILNLAIADECFLIGIPFLLYTMQVGNWPFGNY 215
            :|::||::||.||::||||:.|::||:|.|||||||||||||..::.:|||:.:..:.:||||:.
Zfish    39 IYSVVCLVGLCGNSMVIYVIFRYAKMKTATNIYILNLAIADELLMLSVPFLVTSSLLHHWPFGSL 103

  Fly   216 MCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTPFVSKLVSAFAWMTSVLLMLPVI 280
            :|:..:...:|..|||...|.::|.||||:|.|||.:.|||.|.::|:|:...||.|:|::||:|
Zfish   104 LCRLVLSVDAINMFTSIYCLTVLSIDRYISVVHPIKAARYRRPTIAKMVNLAVWMFSILVILPII 168

  Fly   281 LFASTVQSSNGNVSCNIEWPDTQNSHTDSTFILYSLVLGFATPLTFILVFYCLVIRKLHTVGPKH 345
            :|::|..:|:|:|:||::.|:.:.... :.|::|:.::||..|:..|.:.|.|:|.|:..|..|.
Zfish   169 IFSTTAPNSDGSVACNMQMPEPERQWM-AVFVIYAFLMGFLFPVIAICMCYILIIVKMRVVALKA 232

  Fly   346 KSKEKKRSHRKVTKLVLTVISAYIFCWLPHWISQVALISSAPQRCASRLELAVFLACGCLSYSNS 410
            ..:::|:|.||:|.:|:.|::.::.||:|..|.|:..: ...|..|:..:|||.     |.|:||
Zfish   233 GWQQRKKSERKITLMVMMVVTVFVICWMPFHIVQLVSV-FVQQHNATLSQLAVI-----LGYANS 291

  Fly   411 AMNPILYAFLSDNFKKSFMK 430
            ..|||||.||||||::||.:
Zfish   292 CANPILYGFLSDNFRRSFQR 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 88/215 (41%)
7tm_1 162..417 CDD:278431 102/254 (40%)
sstr1aXP_696666.1 7tm_4 42..>243 CDD:304433 84/201 (42%)
7tm_1 50..298 CDD:278431 102/254 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 229 1.000 Domainoid score I2399
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 267 1.000 Inparanoid score I3008
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000463
OrthoInspector 1 1.000 - - mtm6374
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X22
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
88.060

Return to query results.
Submit another query.