DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and ccr12a

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001038492.1 Gene:ccr12a / 563803 ZFINID:ZDB-GENE-060503-97 Length:355 Species:Danio rerio


Alignment Length:312 Identity:88/312 - (28%)
Similarity:151/312 - (48%) Gaps:58/312 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 YSYNFILKLITMILYALVCIIGLFGNTLVIYVVMRFSKMQTVTNIYILNLAIADECFLIGIPF-L 201
            |..||:|.|:              ||.||:.::.:|.|:.|||||::|||.|:|..|...:|| .
Zfish    51 YYINFLLSLL--------------GNGLVLCIIYKFEKLSTVTNIFLLNLVISDLIFASSLPFWA 101

  Fly   202 LYTMQVGNWPFGNYMCKAYMVSTSITSFTSSI-FLLIMSADRYIAVCHPISSPRYRTPFVSKLVS 265
            :|  ....|.||..:|| ::.|.....|.||| ||.:|:.|||:||.|.|::.:.|....:...|
Zfish   102 VY--HKSEWIFGKNLCK-FVGSCYSVGFNSSILFLTLMTFDRYLAVVHSIAAAQSRRMAYAFGSS 163

  Fly   266 AFAWMTSVLLMLPVILFASTVQSSNGNVSCNIEWPDTQNSHTDSTFILYSLVLG--------FAT 322
            |..|:.|::..:..|:....:::.:| :.|.:       :..:.||:....::|        |..
Zfish   164 AAVWVVSIVASIKDIVLYDVMKTEDG-LLCEM-------TGYNQTFLTKWELIGYYQQFFLFFMV 220

  Fly   323 PLTFILVFYCLV---IRKLHTVGPKHKSKEKKRSHRKVTKLVLTVISAYIFCWLPHWISQVALIS 384
            ||  |:|.||.|   ||.::|     :..||.|:    .||:..::..:..||.|:  :.|.|:.
Zfish   221 PL--IIVLYCYVRITIRIMYT-----RLMEKCRA----VKLIFIIVFTFFICWTPY--NVVILLK 272

  Fly   385 S------APQRCASRLELAVFLACGCLSYSNSAMNPILYAFLSDNFKKSFMK 430
            :      ....|::.|:.|:::... .:|....::|:.|.||...|:..|:|
Zfish   273 AIKTYFKVQNDCSNALDYALYVTRN-FAYLYCCISPVFYTFLGKKFQSHFLK 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 67/228 (29%)
7tm_1 162..417 CDD:278431 77/273 (28%)
ccr12aNP_001038492.1 7tm_1 61..310 CDD:278431 77/273 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.