DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and cmklr1

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001076281.1 Gene:cmklr1 / 557341 ZFINID:ZDB-GENE-060526-126 Length:353 Species:Danio rerio


Alignment Length:346 Identity:89/346 - (25%)
Similarity:162/346 - (46%) Gaps:48/346 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 ESYPSINGTQNETM--VTSVRPHLDHRNRPTQQNGSHYLEYDDDGPDCSYSYNFILKLITMILYA 153
            |.|.::....|.|.  ||....:..|    |.||               ..:..:|.::.:::..
Zfish    11 EDYGNVTDYGNFTFGNVTHEETYYHH----TAQN---------------MCFTQVLCVLLLVINM 56

  Fly   154 LVCIIGLFGNTLVIYVVMRFSKMQTVTNIYILNLAIADECFLIGIPFLLYTMQVGNWPFGNYMCK 218
            |:|::||.||.:||::. .|:..::|...:.|:||::|..|...:||.:......||.||.:|||
Zfish    57 LICLLGLSGNGVVIWIA-GFAMKKSVNTTWYLSLAVSDFIFCAFLPFNIAYSATSNWIFGLFMCK 120

  Fly   219 AYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTPFVSKLVSAFAWMTSVLLMLPVILFA 283
            .......:..|:|...|:|:|.||.:||..|:.:..:||...:.::...||:.|..|.:|.|::.
Zfish   121 FTSFVMFLNMFSSIFILVIISVDRCVAVMFPVWAQNHRTIGKASVLIILAWIASAALSIPSIVYR 185

  Fly   284 STVQSSNGNVSCNIEWPDTQNSHTDSTF-----ILYSLVLGFATPLTFILVFYCLVIRKLHTVGP 343
            . ||:..|...|       .|::|.|.:     .:...:.||..|...|::.|.::|.:|..   
Zfish   186 D-VQNYLGTNDC-------MNNYTSSRYGHKVIAVSRFIFGFIIPFILIILCYTVIIVRLRA--- 239

  Fly   344 KHKSKEKKRSHRKVTKLVLTVISAYIFCWLPHWISQVALISSAPQRCASRLELAVFLACGCL-SY 407
             .|..:..:..:.:|.|:||    :..||||:....:...:...:....||.:.:    |.: :.
Zfish   240 -SKMAKSNKPFKIMTALILT----FFLCWLPYHTFVLIEFNQTFENGIIRLGMQI----GTITAA 295

  Fly   408 SNSAMNPILYAFLSDNFKKSF 428
            :||.:||:||.|:.::|:|.|
Zfish   296 ANSFLNPVLYVFMGNDFRKRF 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 60/220 (27%)
7tm_1 162..417 CDD:278431 68/260 (26%)
cmklr1NP_001076281.1 7tm_4 57..>179 CDD:304433 40/122 (33%)
7tm_1 65..305 CDD:278431 68/260 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.