DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and cysltr1

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001018484.1 Gene:cysltr1 / 553675 ZFINID:ZDB-GENE-050522-250 Length:342 Species:Danio rerio


Alignment Length:294 Identity:73/294 - (24%)
Similarity:149/294 - (50%) Gaps:20/294 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 LYALVCIIGLFGNTLVIYVVMRFSKMQTVTNIYILNLAIADECFLIGIPF-LLYTMQVGNWPFGN 214
            :|:::.:.||.||...:||::|..:..:..:||:|||.::|...:..:|. :||.:..|.|..|:
Zfish    21 VYSIITVFGLMGNGFALYVLLRTYRQTSAFHIYMLNLGVSDLLCVSTLPLRVLYYINKGQWNLGD 85

  Fly   215 YMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTPFVSKLVSAFAWMTSVLLMLPV 279
            ::|:....:..:..:.|..|::.||..|::|:..|:.:.|..|...:.:|....|:...:...|.
Zfish    86 FLCRLSSYALYVNLYCSVFFMMAMSFTRFLAIVFPVQNLRLATEKKAWIVCVCIWIFICMTSSPF 150

  Fly   280 ILFASTVQSSNGNVSCNIEWPDTQNSHTDSTFIL--YSLVLGFATPLTFILVFYCLVIRKL--HT 340
            :|.............| .|.|:...| .|...:|  :|||:||..|...||:.|..::|.|  :|
Zfish   151 LLSGQHTDPLTNKTKC-FEPPEKPGS-LDKLIMLNYFSLVVGFIIPFLVILLCYAGILRTLLRNT 213

  Fly   341 VGPKHKSKEKKRSHRKVTKLVLTVISAYIFCWLPHWISQVALISSAPQRCA-----SRLELAVFL 400
            .|    :.:::.:..|..:|::.|:.|::..::|:.|.:...:....::.|     :.::.:|.:
Zfish   214 SG----ANKQRYTRNKAIRLIIVVMLAFLISFMPYHIQRTLHLHFKSRKSATCEEVNYMQKSVVI 274

  Fly   401 ACGCLSYSNSAMNPILYAFLSDNFK---KSFMKA 431
            .. ||:.:||..:|:||.|..:||:   .:|.:|
Zfish   275 TL-CLAAANSCFDPMLYFFSGENFRHRLSTFRRA 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 56/220 (25%)
7tm_1 162..417 CDD:278431 63/264 (24%)
cysltr1NP_001018484.1 7tm_4 24..244 CDD:304433 56/225 (25%)
7tm_1 32..290 CDD:278431 63/264 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.