DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and Cxcr1

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_062183.1 Gene:Cxcr1 / 54258 RGDID:2905 Length:349 Species:Rattus norvegicus


Alignment Length:306 Identity:87/306 - (28%)
Similarity:148/306 - (48%) Gaps:34/306 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 MILYALVCIIGLFGNTLVIYVVMRFSKMQTVTNIYILNLAIADECFLIGIPFLLYTMQVGNWPFG 213
            ::.||||.::.|.||:||:.|::...:.::||::|:|||||||..|.:.:|||..:...| |.||
  Rat    48 VVFYALVFLLSLLGNSLVMLVILYRRRTRSVTDVYVLNLAIADLLFSLTLPFLAVSKWKG-WIFG 111

  Fly   214 NYMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCH---PISSPRYRTPFVSKLVSAFAWMTSVLL 275
            ..:||...:...:..|:..:.|..:|.|||:|:.|   .::..||    :.|.|....|..|::|
  Rat   112 TPLCKMVSLLKEVNFFSGILLLACISVDRYLAIVHATRTLTRKRY----LVKFVCMGTWGLSLVL 172

  Fly   276 MLPVILFASTVQSSNGNVSCNIEWPDTQNSHTDSTFILYSL--VLGFATPLTFILVFYCLVIRKL 338
            .||..:|....:.......|   :.....:..|....|..|  :.||..||..:||.|.|.:|.|
  Rat   173 SLPFAIFRQAYKPYRSGTVC---YEVLGEATADLRITLRGLSHIFGFLLPLFIMLVCYGLTLRTL 234

  Fly   339 HTVGPKHKSKEKKRSHRKVTKLVLTVISAYIFCWLPHWISQVALISSA-------PQRCASR--L 394
            .        |...|..|:...::..|:..::.|.||:   .:.|:|..       ...|..|  :
  Rat   235 F--------KAHMRQKRRAMWVIFAVVLVFLLCCLPY---NLVLLSDTLLGAHLIQDTCERRNNI 288

  Fly   395 ELAVFLACGCLSYSNSAMNPILYAFLSDNFKKSFMKACTCAARKDV 440
            :.|:::. ..|.:|:|.:||::|||:..:|:..|:|.......|:|
  Rat   289 DQALYIT-EILGFSHSCLNPVIYAFVGQSFRHEFLKILANLVHKEV 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 62/220 (28%)
7tm_1 162..417 CDD:278431 74/268 (28%)
Cxcr1NP_062183.1 7tm_1 61..310 CDD:278431 74/268 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.