DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and P2RY13

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_795713.2 Gene:P2RY13 / 53829 HGNCID:4537 Length:354 Species:Homo sapiens


Alignment Length:319 Identity:76/319 - (23%)
Similarity:145/319 - (45%) Gaps:27/319 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 ILKLITMILYALVCIIGLFGNTLVIYVVMRFSKMQTVTNIYILNLAIADECFLIGIPF-LLYTMQ 206
            |::|:...||.:|.:.|:..|||.::|.:......|.. ||:.|..:||....:.:|| :|....
Human    42 IVQLVFPALYTVVFLTGILLNTLALWVFVHIPSSSTFI-IYLKNTLVADLIMTLMLPFKILSDSH 105

  Fly   207 VGNWPFGNYMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTPFVSKLVSAFAWMT 271
            :..|....::|:...|....|.:...:.|.:::.||::.:..|:.:...:.|..:|.||.|.|..
Human   106 LAPWQLRAFVCRFSSVIFYETMYVGIVLLGLIAFDRFLKIIRPLRNIFLKKPVFAKTVSIFIWFF 170

  Fly   272 SVLLMLPVILFASTVQSSNGNVSC-------NIEWPDTQNSHTDSTFILYSLVLGFATPLTFILV 329
            ...:.||..:.::...:.:....|       .::|....|:...  ||       |.|....:||
Human   171 LFFISLPNTILSNKEATPSSVKKCASLKGPLGLKWHQMVNNICQ--FI-------FWTVFILMLV 226

  Fly   330 FYCLVIRKLHTVGPKHKSKEKKRSHRKVTKLVLTVISAYIFCWLPHWISQVALI-SSAPQRCASR 393
            ||.::.:|::....|.|||::| :::|:...|..|::.:..|:.|...::|... |....:...|
Human   227 FYVVIAKKVYDSYRKSKSKDRK-NNKKLEGKVFVVVAVFFVCFAPFHFARVPYTHSQTNNKTDCR 290

  Fly   394 LELAVFLACGC---LSYSNSAMNPILYAFLSDNFKKSFMKACTCAARKDVNAQLQLENS 449
            |:..:|:|...   |:.:|..|:|::|.||.    |.|.:...|...:...|..|..:|
Human   291 LQNQLFIAKETTLFLAATNICMDPLIYIFLC----KKFTEKLPCMQGRKTTASSQENHS 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 50/223 (22%)
7tm_1 162..417 CDD:278431 61/266 (23%)
P2RY13NP_795713.2 7tm_1 62..317 CDD:278431 61/265 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 335..354 3/11 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.