DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and OPRM1

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001138751.1 Gene:OPRM1 / 4988 HGNCID:8156 Length:493 Species:Homo sapiens


Alignment Length:316 Identity:113/316 - (35%)
Similarity:180/316 - (56%) Gaps:19/316 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 SYNFILKLITMILYALVCIIGLFGNTLVIYVVMRFSKMQTVTNIYILNLAIADECFLIGIPFLLY 203
            |.:.|..:..|.||::||::|||||.||:||::|::||:|.|||||.|||:||......:||...
Human   157 SPSMITAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSV 221

  Fly   204 TMQVGNWPFGNYMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTPFVSKLVSAFA 268
            ...:|.||||..:||..:.......|||...|..||.|||||||||:.:..:|||..:|:::...
Human   222 NYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIINVCN 286

  Fly   269 WMTSVLLMLPVILFASTVQSSNGNVSCNIEWPDTQNSHT----DSTFILYSLVLGFATPLTFILV 329
            |:.|..:.||| :|.:|.:...|::.|.:.:     ||.    ::...:...:..|..|:..|.|
Human   287 WILSSAIGLPV-MFMATTKYRQGSIDCTLTF-----SHPTWYWENLLKICVFIFAFIMPVLIITV 345

  Fly   330 FYCLVIRKLHTVGPKHKSKEKKRSHRKVTKLVLTVISAYIFCWLP-HWISQVALISSAPQRCASR 393
            .|.|:|.:|.:|.....||||.|:.|::|::||.|::.:|.||.| |....:..:.:.|:   :.
Human   346 CYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALVTIPE---TT 407

  Fly   394 LELAVFLACGCLSYSNSAMNPILYAFLSDNFKKSFMKACTCAARKDVNAQLQLENS 449
            .:...:..|..|.|:||.:||:|||||.:|||:.|.:.|.     ..::.::.:||
Human   408 FQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCI-----PTSSNIEQQNS 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 83/219 (38%)
7tm_1 162..417 CDD:278431 91/259 (35%)
OPRM1NP_001138751.1 7tm_4 172..>376 CDD:304433 80/209 (38%)
7tm_1 180..431 CDD:278431 91/259 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 209 1.000 Inparanoid score I3681
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X22
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.