DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and OPRL1

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001305782.1 Gene:OPRL1 / 4987 HGNCID:8155 Length:399 Species:Homo sapiens


Alignment Length:382 Identity:127/382 - (33%)
Similarity:191/382 - (50%) Gaps:46/382 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 LKLITMILYALVCIIGLFGNTLVIYVVMRFSKMQTVTNIYILNLAIADECFLIGIPFLLYTMQVG 208
            ||:..:.||..||:.||.||.||:||::|.:||:|.|||||.|||:||...|:.:||....:.:|
Human    50 LKVTIVGLYLAVCVGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQGTDILLG 114

  Fly   209 NWPFGNYMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTPFVSKLVSAFAWMTSV 273
            .|||||.:||..:.......|||:..|..||.|||:|:||||.:...||...::.|:...|..:.
Human   115 FWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALAS 179

  Fly   274 LLMLPVILFASTVQSSNGNVSCNIEWPDTQNSHTDSTFILYSLVLGFATPLTFILVFYCLVIRKL 338
            ::.:||.:..| .|..:..:.|.:|.| |...:....|.:...:..|..|:..|.|.|.|:||:|
Human   180 VVGVPVAIMGS-AQVEDEEIECLVEIP-TPQDYWGPVFAICIFLFSFIVPVLVISVCYSLMIRRL 242

  Fly   339 HTVGPKHKSKEKKRSHRKVTKLVLTVISAYIFCWLPHWISQVALISSAPQRCASRLELAVFLACG 403
            ..|.....|:||.|:.|::|:|||.|::.::.||.|  :....|......:.:|...:|:...|.
Human   243 RGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTP--VQVFVLAQGLGVQPSSETAVAILRFCT 305

  Fly   404 CLSYSNSAMNPILYAFLSDNFKKSFMK-ACTCAARKDVNAQLQLENSFFPKFGKGRQSERLLGGN 467
            .|.|.||.:||||||||.:|||..|.| .|..|.|:||..                 |:|:    
Human   306 ALGYVNSCLNPILYAFLDENFKACFRKFCCASALRRDVQV-----------------SDRV---- 349

  Fly   468 GKGGAQRGALTKKKCLATRNN-----------NAPMATTTTTTTTTTGTD--AVTCL 511
                   .::.|...||.:.:           :.||...:..:.:|..|:  .||.|
Human   350 -------RSIAKDVALACKTSETVPRPAXLGVDLPMVPVSPQSPSTPNTELTQVTAL 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 81/215 (38%)
7tm_1 162..417 CDD:278431 92/254 (36%)
OPRL1NP_001305782.1 7tm_4 66..>188 CDD:304433 52/121 (43%)
7tm_1 68..319 CDD:278431 92/254 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 209 1.000 Inparanoid score I3681
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X22
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.