DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and C5ar2

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:XP_006228414.1 Gene:C5ar2 / 445269 RGDID:1303027 Length:386 Species:Rattus norvegicus


Alignment Length:366 Identity:86/366 - (23%)
Similarity:158/366 - (43%) Gaps:51/366 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 VESESYPSINGTQNETMVTSVRPHLDHRNRPTQQNGSHYLEYDDDGPDCSYSYNFILKLITMILY 152
            :.|....:::|.:.....||    .|:.....|:..|..|....|.|..:...|....::.:.||
  Rat    31 MSSTELRTVSGARMLNDTTS----KDYEYEYDQEQYSDLLNVPVDCPAGNCFSNDAYLIVLLGLY 91

  Fly   153 ALVCIIGLFGNTLVIYVVMRFSKMQTVTNIYILNLAIADECFLIGIPFLLYTM-QVGNWPFGNYM 216
            :::.::|:.||||:.:|..:.|:.:...: :.|:|.:||....:.:|||...: |.|:||:|...
  Rat    92 SVIFLVGVPGNTLLAWVTWKESRHRLGAS-WFLHLTMADLLCCVSLPFLAVPIAQKGHWPYGTAG 155

  Fly   217 CKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPI-SSPRYRTPFVSKLVSAFAWMTSVLLMLPVI 280
            |......|.::.:.|.:.|..:|.|.::....|. .:...||..| ::|...:||.::||.:|..
  Rat   156 CWLLSSITVLSMYASVLLLTGLSGDLFLLAFRPSWKNADQRTCGV-RVVQVSSWMLALLLTVPGA 219

  Fly   281 LFASTVQ-----------SSNGNVSCNIEWPDTQNSHTDSTFILYSLVLGFATPLTFILVFYCLV 334
            ::...:|           :..|:|:..:            |......:.||..||.|:...:.::
  Rat   220 VYRKLLQEHYPPRLVCGTNYGGSVTAEV------------TITTVRFLFGFLVPLVFMASCHGIL 272

  Fly   335 IRKLHTVGPKHKSKEKKRSHRKVTKLVLTVISAYIFCWLPHWISQV--ALISSAPQRCASRLELA 397
            .|::               .|:...|...|:..:..||.|..:.:|  |:.||.....|..|| |
  Rat   273 QRQM---------------ARRHWPLGTAVVVGFFICWTPFHLLRVIIAVASSHSPLLAWALE-A 321

  Fly   398 VFLACGCLSYSNSAMNPILYAFLS-DNFKKSFMKACTCAAR 437
            ..|..| |:.::||:|||::.:.. ....||...||..|.|
  Rat   322 EPLVTG-LALAHSALNPIMFLYFGRKQLCKSLQAACHWALR 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 48/228 (21%)
7tm_1 162..417 CDD:278431 66/269 (25%)
C5ar2XP_006228414.1 7tm_1 101..338 CDD:278431 64/267 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.