DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and CXCR1

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_000625.1 Gene:CXCR1 / 3577 HGNCID:6026 Length:350 Species:Homo sapiens


Alignment Length:321 Identity:90/321 - (28%)
Similarity:149/321 - (46%) Gaps:46/321 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 DDDGPDCSYSYNFILKLITMILYALVCIIGLFGNTLVIYVVMRFSKMQTVTNIYILNLAIADECF 194
            |:|...|......:.|.:.:|.||||.::.|.||:||:.|::.....::||::|:||||:||..|
Human    24 DEDYSPCMLETETLNKYVVIIAYALVFLLSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLF 88

  Fly   195 LIGIPFLLYTMQVGNWPFGNYMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTPF 259
            .:.:| :....:|..|.||.::||...:...:..::..:.|..:|.|||:|:.|...:...:...
Human    89 ALTLP-IWAASKVNGWIFGTFLCKVVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRHL 152

  Fly   260 VSKLVSAFAWMTSVLLMLPVILFASTVQSSNGNVSC-NIEWPDTQN--------SHTDSTFILYS 315
            | |.|....|..|:.|.||..||......:|.:..| .:...||..        .||        
Human   153 V-KFVCLGCWGLSMNLSLPFFLFRQAYHPNNSSPVCYEVLGNDTAKWRMVLRILPHT-------- 208

  Fly   316 LVLGFATPLTFILVFYCLVIR---KLHTVGPKHKSKEKKRSHRKVTKLVLTVISAYIFCWLPHWI 377
              .||..||..:|..|...:|   |.| :|.||::          .:::..|:..::.||||:  
Human   209 --FGFIVPLFVMLFCYGFTLRTLFKAH-MGQKHRA----------MRVIFAVVLIFLLCWLPY-- 258

  Fly   378 SQVALISSAPQR-------CASRLELAVFL-ACGCLSYSNSAMNPILYAFLSDNFKKSFMK 430
             .:.|::....|       |..|..:...| |...|.:.:|.:|||:|||:..||:..|:|
Human   259 -NLVLLADTLMRTQVIQESCERRNNIGRALDATEILGFLHSCLNPIIYAFIGQNFRHGFLK 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 59/227 (26%)
7tm_1 162..417 CDD:278431 73/274 (27%)
CXCR1NP_000625.1 7tm_1 56..305 CDD:278431 73/274 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.