DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and oprd1b

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_997920.2 Gene:oprd1b / 336529 ZFINID:ZDB-GENE-030131-8473 Length:375 Species:Danio rerio


Alignment Length:304 Identity:113/304 - (37%)
Similarity:178/304 - (58%) Gaps:11/304 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 LYALVCIIGLFGNTLVIYVVMRFSKMQTVTNIYILNLAIADECFLIGIPFLLYTMQVGNWPFGNY 215
            ||:::|::||.||.||:|.|:|::||:|.|||||.|||:||......:||......:|.||||..
Zfish    60 LYSVICVVGLVGNVLVMYGVVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMGTWPFGEL 124

  Fly   216 MCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTPFVSKLVSAFAWMTSVLLMLPVI 280
            :||..:.......|||...|.:||.|||||||||:.:..:|||..:|:::...|:.|..:..||:
Zfish   125 LCKVVIAIDYYNMFTSIFTLTMMSVDRYIAVCHPVRALDFRTPVKAKIINICVWILSSAVGFPVM 189

  Fly   281 LFASTVQSSNGNVSCNIEWPDTQNSHTDSTFILYSLVLGFATPLTFILVFYCLVIRKLHTVGPKH 345
            :.|.|.:..:|...|.:::||.: .:.|:...:...:..|..|:..|.|.|.|:|.:|.:|....
Zfish   190 VMAVTKELDSGKTICMLKFPDPE-WYWDTVTKICVFIFAFVFPVLVITVCYGLMILRLKSVRLLS 253

  Fly   346 KSKEKKRSHRKVTKLVLTVISAYIFCWLP-HWISQVALISSAPQRCASRLELAVFLACGCLSYSN 409
            .||||.|:.|::|::||.|::|:|.||.| |....|..:....|:  :.|.:|.:..|..|.|.|
Zfish   254 GSKEKDRNLRRITRMVLVVVAAFIICWTPIHIFIIVKTVVEIDQK--NLLVVACWHLCIALGYMN 316

  Fly   410 SAMNPILYAFLSDNFKKSFMKACTCAARKDVNAQLQLENSFFPK 453
            |::||:|||||.:|||:.|.:.|       :..:.::|.:.|.|
Zfish   317 SSLNPVLYAFLDENFKRCFREFC-------LPFRTRIEQNSFSK 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 83/215 (39%)
7tm_1 162..417 CDD:278431 95/255 (37%)
oprd1bNP_997920.2 7tm_1 76..324 CDD:278431 91/250 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X22
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.