DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and Fpr-rs7

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:XP_030106054.1 Gene:Fpr-rs7 / 321021 MGIID:2448177 Length:338 Species:Mus musculus


Alignment Length:335 Identity:90/335 - (26%)
Similarity:169/335 - (50%) Gaps:36/335 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 QNGSHYLEYDDDGPDCSYSYNFILKLITMILYALVCIIGLFGNTLVIYVVMRFSKMQTVTNIYIL 185
            ||||..:.||.       :.:.::.:..:::.::..::|:.||.|||||. .|....|||.|..|
Mouse     9 QNGSEVVFYDS-------TTSRVICIFLVVVLSITFLLGVIGNGLVIYVA-GFRMTHTVTTICYL 65

  Fly   186 NLAIADECFLIGIPFLLYTMQV-GNWPFGNYMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHP 249
            |||::|..::..:||.:.::.: |.|.||.::||...:..::..|.|...:..::.||.|.|.||
Mouse    66 NLALSDFSYMTSLPFQITSIVMNGEWLFGWFLCKFVHMIINVNLFLSIFLITFIAMDRCICVLHP 130

  Fly   250 ISSPRYRTPFVSKLVSAFAWMTSVLLMLPVILFASTVQSSNGNVS--CNIE-WPDTQNSHTDSTF 311
            :.:..:||..:::.|...:|:..::|:.|...|.:||:..:|.|.  ||.| |..|.....:.:.
Mouse   131 VWAQNHRTVNLARKVILGSWILVLMLIFPHFFFLTTVKDESGKVHCICNFESWAATPEEQVNMSM 195

  Fly   312 ------ILYSLVLGFATPLTFILVFYCLVIRKLHTVGPKHKSKEKKRSHRKVTKLVLTVIS-AYI 369
                  :..|.::||:.|:.||::.|.|:..|:...|..:.|:..:         |||.:: ::.
Mouse   196 TVSLISVTLSFIVGFSIPMIFIVICYGLMAAKIGRRGLVNSSRPLR---------VLTAVAFSFF 251

  Fly   370 FCWLPHWISQVALISS-APQRCASRLELAVFLACGCLSYSNSAMNPILYAFLSDNFKKSFMKACT 433
            .||.|..:  :.|:.: ..:...:.::..|..|....|: ||.:|||||.||...|::..:.:.:
Mouse   252 VCWFPFQL--IFLLGNIGNKETQNNIDAWVNPASTLASF-NSCLNPILYVFLGQQFRERLIYSLS 313

  Fly   434 C----AARKD 439
            .    |.|:|
Mouse   314 ASLERALRED 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 64/226 (28%)
7tm_1 162..417 CDD:278431 75/266 (28%)
Fpr-rs7XP_030106054.1 7tm_GPCRs 27..308 CDD:391938 81/293 (28%)
TM helix 1 29..53 CDD:341315 8/24 (33%)
TM helix 2 61..82 CDD:341315 8/20 (40%)
TM helix 3 99..121 CDD:341315 3/21 (14%)
TM helix 4 144..160 CDD:341315 3/15 (20%)
TM helix 5 200..222 CDD:341315 6/21 (29%)
TM helix 6 237..262 CDD:341315 7/35 (20%)
TM helix 7 280..301 CDD:341315 10/21 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.