DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and Npbwr1

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001014784.1 Gene:Npbwr1 / 297795 RGDID:1305917 Length:329 Species:Rattus norvegicus


Alignment Length:294 Identity:104/294 - (35%)
Similarity:167/294 - (56%) Gaps:8/294 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 LKLITMILYALVCIIGLFGNTLVIYVVMRFSKMQTVTNIYILNLAIADECFLIGIPFLLYTMQVG 208
            |.:...::|.::|.:||.||:.|:||::|..:|:||||::|||||||||.|.:.:|..:....:.
  Rat    38 LAVAVPVVYGVICAVGLAGNSAVLYVLLRTPRMKTVTNVFILNLAIADELFTLVLPINIADFLLR 102

  Fly   209 NWPFGNYMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRY--RTPFVSKLVSAFAWMT 271
            .||||..|||..:......:|:|..||.:||||||:.|.....|.|.  ||...::.||...|..
  Rat   103 RWPFGEVMCKLIVAVDQYNTFSSLYFLAVMSADRYLVVLATAESRRVSGRTYGAARAVSLAVWAL 167

  Fly   272 SVLLMLPVILFASTVQSSNGNVSCNIEWPDTQNSHTDSTFILYSLVLGFATPLTFILVFYCLVIR 336
            ..|::||..:|| .:....|...|.:.:|..:.....:: .||:||||||.|::.|...|..::.
  Rat   168 VTLVVLPFAVFA-RLDEEQGRRQCVLVFPQPEAFWWRAS-RLYTLVLGFAIPVSTICALYITLLC 230

  Fly   337 KLHTVGPKHKSKEKKRSHRKVTKLVLTVISAYIFCWLPHWISQ-VALISSAPQRCASRLELAVFL 400
            :|..:.....:|...|:.::||.||:.:::..:.||.|:.:|. |||.:..||   :.|.:.:..
  Rat   231 RLRAIQLDSHAKALDRAKKRVTLLVVAILAVCLLCWTPYHLSTIVALTTDLPQ---TPLVIGISY 292

  Fly   401 ACGCLSYSNSAMNPILYAFLSDNFKKSFMKACTC 434
            ....|||:||.:||.|||||.|:|::|..:..:|
  Rat   293 FITSLSYANSCLNPFLYAFLDDSFRRSLRQLVSC 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 76/217 (35%)
7tm_1 162..417 CDD:278431 90/257 (35%)
Npbwr1NP_001014784.1 7tm_1 56..309 CDD:278431 90/257 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X22
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.