DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and Fpr-rs3

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001162611.1 Gene:Fpr-rs3 / 292419 RGDID:1309032 Length:343 Species:Rattus norvegicus


Alignment Length:332 Identity:100/332 - (30%)
Similarity:165/332 - (49%) Gaps:38/332 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 NGSHYLEYDDDGPDCSYSYNFILKLITMILYALVCIIGLFGNTLVIYVVMRFSKMQTVTNIYILN 186
            |||..:.||.       :.:.:|.::::::.::..::|:.||.|||:|. .|....|||.|..||
  Rat    10 NGSEVVFYDS-------TTSTVLWILSVVVLSITFVLGVLGNGLVIWVA-GFRMAHTVTTICYLN 66

  Fly   187 LAIADECFLIGIPFLLYTMQV-GNWPFGNYMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPI 250
            ||:.|..|:..:|..:.:|.: |.|.||.::||.......|..|.|...:.:::.||...|.||:
  Rat    67 LALGDFSFMATLPIHIISMVMKGKWLFGWFLCKFVHSIVHINLFASVFLITLIAMDRCTCVLHPV 131

  Fly   251 SSPRYRTPFVSKLVSAFAWMTSVLLMLPVILFASTVQSSNGNV--SCNIEW----PDTQ--NSHT 307
            .:..:||..:::.|...||:.|:||.||..||.:||:...|.|  :||.|.    |:.|  .|..
  Rat   132 WAQNHRTVGLARKVVVGAWILSLLLTLPHFLFLTTVRDPRGEVHCTCNFESVVANPEEQLKVSII 196

  Fly   308 DSTFI-LYSLVLGFATPLTFILVFYCLVIRKLHTVGPKHKSKEKKRSHRKVTKLVLTVISAYIFC 371
            .||.| :.|.::||:.|::||.:.|.|:..|:       ..|:...|.|.:..|....|| :..|
  Rat   197 VSTAIGIISFIIGFSLPMSFIAICYGLMAVKI-------CRKDFLNSSRPLRVLSAVAIS-FFMC 253

  Fly   372 WLPHWISQVALISS-----APQRCASRLELAVFLACGCLSYSNSAMNPILYAFLSDNFKKSFMKA 431
            |.|..:  :.|:.:     .|......|..|..||    |: ||.:|||||.||...|::..:.:
  Rat   254 WFPFQL--IILLGNIWNKETPNSIHILLNPASTLA----SF-NSCLNPILYVFLGQEFREKLIHS 311

  Fly   432 CTCAARK 438
            .:.:..:
  Rat   312 LSASLER 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 74/225 (33%)
7tm_1 162..417 CDD:278431 88/269 (33%)
Fpr-rs3NP_001162611.1 7tm_1 43..297 CDD:278431 88/269 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.