DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and Fpr3

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:XP_003748922.1 Gene:Fpr3 / 292413 RGDID:1566044 Length:351 Species:Rattus norvegicus


Alignment Length:299 Identity:82/299 - (27%)
Similarity:154/299 - (51%) Gaps:26/299 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 ILKLITMILYALVCIIGLFGNTLVIYVVMRFSKMQTVTNIYILNLAIADECFLIGIP-FLLYTMQ 206
            :|.::||::.::..::|:.||.|||:|. .|....|||....||||:||..|...:| |::.|..
  Rat    24 VLWILTMVVLSITFVLGVLGNGLVIWVA-GFRMAHTVTTTCYLNLALADFFFTATLPFFIISTAM 87

  Fly   207 VGNWPFGNYMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTPFVSKLVSAFAWMT 271
            .|.||||.::||...:...:....|...:.:::.||.|.|.||:.:..:||..:::.|....|:.
  Rat    88 EGKWPFGWFLCKLLYIIADVNGIGSIFLITLIALDRCICVVHPVWAQNHRTVSLARKVVIGPWIF 152

  Fly   272 SVLLMLPVILFASTVQSSNGNVSCNIEWPDTQNSHTD--STFILYSLVLG-------FATPLTFI 327
            .::|.|.:.:|.||.:.|.|:|.|...:|...|:..:  :|..:::..||       |..|::.:
  Rat   153 GLILSLHIFIFISTYRVSGGDVYCVYYFPSWGNTDEEMLNTVFIFTTALGIIKFIIIFIIPMSIV 217

  Fly   328 LVFYCLVIRKLHTVGPKHKSKEKKRSHRKVTKLVLTVISAYIFCWLPHWISQVALISSA--PQRC 390
            .:.|.|:..|:......:.|        :.::::..|::::..||.|..:  |||:|..  .:|.
  Rat   218 SICYGLIAVKIQRRALVNSS--------RASRVLKAVVASFFICWFPFQL--VALLSLVWFKERL 272

  Fly   391 AS---RLELAVFLACGCLSYSNSAMNPILYAFLSDNFKK 426
            .:   ::...:.:....|::.||.:|||||.|...:|:|
  Rat   273 LNDEYKIIDMLIMPTNSLAFFNSCLNPILYVFFGQDFRK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 60/225 (27%)
7tm_1 162..417 CDD:278431 73/269 (27%)
Fpr3XP_003748922.1 7tm_1 43..302 CDD:278431 73/269 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.