DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and C5AR2

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001258678.1 Gene:C5AR2 / 27202 HGNCID:4527 Length:337 Species:Homo sapiens


Alignment Length:342 Identity:81/342 - (23%)
Similarity:144/342 - (42%) Gaps:56/342 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 NGSHYLEYDD-----DGP-DCSYSYNFI---LKLITMILYALVCIIGLFGNTLVIYVVMRFSKMQ 177
            |.|...||.|     |.| ||.......   |::..:.|||.:.::|:.||.:|.:|..:.:: :
Human     3 NDSVSYEYGDYSDLSDRPVDCLDGACLAIDPLRVAPLPLYAAIFLVGVPGNAMVAWVAGKVAR-R 66

  Fly   178 TVTNIYILNLAIADECFLIGIPFLLYTM-QVGNWPFGNYMCKAYMVSTSITSFTSSIFLLIMSAD 241
            .|...::|:||:||....:.:|.|...: :.|:||:|...|:|......:|.:.|.:.|..:|||
Human    67 RVGATWLLHLAVADLLCCLSLPILAVPIARGGHWPYGAVGCRALPSIILLTMYASVLLLAALSAD 131

  Fly   242 RYIAVCHPISSPRY-----RTPFVSKLVSAFAWMTSVLLMLPVILFASTVQSS-NGNVSCNIEW- 299
                :|.....|.:     |...|.....| ||..::||.:|..::....|.. ...:.|.::: 
Human   132 ----LCFLALGPAWWSTVQRACGVQVACGA-AWTLALLLTVPSAIYRRLHQEHFPARLQCVVDYG 191

  Fly   300 --PDTQNSHTDSTFILYSLVLGFATPLTFIL----VFYCLVIRKLHTVGPKHKSKEKKRSHRKVT 358
              ..|:|:.|...|:     .||..||..:.    ...|...|:...:|                
Human   192 GSSSTENAVTAIRFL-----FGFLGPLVAVASCHSALLCWAARRCRPLG---------------- 235

  Fly   359 KLVLTVISAYIFCWLPHWISQVALISSAPQRC-ASRLELAVFLACGCLSYSNSAMNPILYAFLS- 421
               ..::..:..||.|:.:..:.|..:||... .:|...|..|..| |:.::|.:||:|:.:.. 
Human   236 ---TAIVVGFFVCWAPYHLLGLVLTVAAPNSALLARALRAEPLIVG-LALAHSCLNPMLFLYFGR 296

  Fly   422 DNFKKSFMKACTCAARK 438
            ...::|...||..|.|:
Human   297 AQLRRSLPAACHWALRE 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 48/229 (21%)
7tm_1 162..417 CDD:278431 61/269 (23%)
C5AR2NP_001258678.1 7tm_1 52..290 CDD:278431 61/268 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.