DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and FPR2

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001005738.1 Gene:FPR2 / 2358 HGNCID:3827 Length:351 Species:Homo sapiens


Alignment Length:334 Identity:96/334 - (28%)
Similarity:164/334 - (49%) Gaps:49/334 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 NRPTQQNGSHYLEYDDDGPDCSYSYNFILKLITMILYALVCIIGLFGNTLVIYVVMRFSKMQTVT 180
            |..|..|....:.|:..|    |:   :|:::.:::..:..::|:.||.|||:|. .|...:|||
Human     4 NFSTPLNEYEEVSYESAG----YT---VLRILPLVVLGVTFVLGVLGNGLVIWVA-GFRMTRTVT 60

  Fly   181 NIYILNLAIADECFLIGIPFLLYTMQVG-NWPFGNYMCKAYMVSTSITSFTSSIFLL-IMSADRY 243
            .|..||||:||..|...:|||:.:|.:| .||||.::||...:...|..| .|:||: .::.||.
Human    61 TICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLF-GSVFLIGFIALDRC 124

  Fly   244 IAVCHPISSPRYRTPFVSKLVSAFAWMTSVLLMLPVILFASTVQSSNGNVSCNI---EWPDTQNS 305
            |.|.||:.:..:||..::..|....|:.:::|.|||.||.:||...||:..|..   .|..|...
Human   125 ICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEE 189

  Fly   306 HTDSTFILYS------LVLGFATPLTFILVFYCLVIRKLHTVGPKHKSKEKKRSHRKVTKLVLT- 363
            .......:.:      .|:||:.|::.:.:.|.|:..|:|..|....|:..:         ||| 
Human   190 RLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLR---------VLTA 245

  Fly   364 VISAYIFCWLPHWISQVALISSAPQRCASRLELAVFLA-----------CGCLSYSNSAMNPILY 417
            |::::..||.|..:  |||:.:.      .|:..:|..           ...|::.||.:||:||
Human   246 VVASFFICWFPFQL--VALLGTV------WLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLY 302

  Fly   418 AFLSDNFKK 426
            .|:..:|::
Human   303 VFVGQDFRE 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 72/227 (32%)
7tm_1 162..417 CDD:278431 84/277 (30%)
FPR2NP_001005738.1 7tmA_FPR-like 27..313 CDD:320245 89/304 (29%)
TM helix 1 28..54 CDD:320245 7/26 (27%)
TM helix 2 60..85 CDD:320245 12/24 (50%)
TM helix 3 98..128 CDD:320245 10/30 (33%)
TM helix 4 140..160 CDD:320245 4/19 (21%)
TM helix 5 198..223 CDD:320245 5/24 (21%)
TM helix 6 234..264 CDD:320245 11/40 (28%)
TM helix 7 281..306 CDD:320245 8/24 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 325..351
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.