DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and Gpr171

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_775574.1 Gene:Gpr171 / 229323 MGIID:2442043 Length:319 Species:Mus musculus


Alignment Length:321 Identity:82/321 - (25%)
Similarity:147/321 - (45%) Gaps:33/321 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 LKLITMILYALVCIIGLFGNTLVIYVVMRFSKMQTVTNIYILNLAIADECFLIGIPF-LLYTMQV 207
            |:..|...| ||.:||:.|:....:..::.:......:||::||..||....:.:|. ::..:.|
Mouse    14 LEPFTYFFY-LVFLIGIIGSCFATWAFIQKTTNHRCVSIYLINLLTADFLLTLALPVKIIVDLGV 77

  Fly   208 GNWPFGNYMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTPFVSKLVSAFAWMTS 272
            ..|....:.|:.......|..:.|.|||..:|.||.:.:.|.....|.:.|..:|::||..|:..
Mouse    78 APWKLRIFHCQVTACLIYINMYLSIIFLAFVSIDRCLQLIHSCKIYRIQEPGFAKMISAVVWLMV 142

  Fly   273 VLLMLPVILFASTVQSSNGNVSCNIEWPDT--QNSHTDSTFILYSLVLGFATPLTFILVFYCLVI 335
            :|:|:|.::..........||.| :|:...  :|.|..:.||..::.|.|:   ..||:...|.|
Mouse   143 LLIMVPNMVIPIKDIKEKSNVGC-MEFKKEFGRNWHLLTNFICVAIFLNFS---VIILISNFLAI 203

  Fly   336 RKLHTVGPKHKSKEKKRSHRKVTKLVLTVISAYIFCW-------LPHWISQVALISSAPQRCASR 393
            |:|:    :::......|.:.....:|.|.::||.|:       :|:.:||..:||.    |::|
Mouse   204 RQLY----RNRDNTNYPSVKSALLHILLVTASYIICFVPYHAVRIPYTLSQTEVISD----CSTR 260

  Fly   394 LEL-----AVFLACGCLSYSNSAMNPILYAFLSDNFKKSFMKACTCAAR-KDVNAQLQLEN 448
            :.|     |..|    |:.||...:||||..||..|:....:......: |.:..:|:.||
Mouse   261 IALFKAKEATLL----LAVSNLCFDPILYYHLSKAFRLKVTETFASPKKSKPLEERLRSEN 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 52/218 (24%)
7tm_1 162..417 CDD:278431 66/269 (25%)
Gpr171NP_775574.1 7tm_1 37..285 CDD:278431 65/263 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.