DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and Cxcr1

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_839972.1 Gene:Cxcr1 / 227288 MGIID:2448715 Length:351 Species:Mus musculus


Alignment Length:308 Identity:90/308 - (29%)
Similarity:148/308 - (48%) Gaps:36/308 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 MILYALVCIIGLFGNTLVIYVVMRFSKMQTVTNIYILNLAIADECFLIGIPFLLYTMQVGNWPFG 213
            ::.||||.::.|.||:||:.|::...:.::|.::|:|||||||..|.:.:|||..:...| |.||
Mouse    48 VVFYALVSLLSLLGNSLVMLVILYRRRTRSVMDVYVLNLAIADLLFSLTLPFLAVSKLKG-WIFG 111

  Fly   214 NYMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCH---PISSPRYRTPFVSKLVSAFAWMTSVLL 275
            ..:||...:......|:..:.|..:|.|||:|:.|   .::..||    :.|.|....|..|::|
Mouse   112 TPLCKMVSLLKEFNFFSGILLLACISVDRYLAIVHATRTLARKRY----LVKFVCVGIWGLSLIL 172

  Fly   276 MLPVILFASTVQSSNGNVSCNIEWPDTQNSHTDSTFILYSL--VLGFATPLTFILVFYCLVIRKL 338
            .||..:|....:.......|   :.....:.||....|..|  :.||..||..:||.|.|.:|.|
Mouse   173 SLPFAIFRQAYKPFRSGTVC---YEVLGEATTDFRMTLRGLSHIFGFLLPLLTMLVCYGLTLRML 234

  Fly   339 HTVGPKHKSKEKKRSHRKVTKLVLTVISAYIFCWLPHWISQVALISSA-------PQRCASR--L 394
            .        |...|...:...::..|:..::.|.||:   .:.|:|..       ...|..|  :
Mouse   235 F--------KTHMRQKHRAMGVIFAVVLVFLLCCLPY---NLVLLSDTLLGAHLIEDTCERRNDI 288

  Fly   395 ELAVFLACGCLSYSNSAMNPILYAFLSDNFKKSFMK--ACTCAARKDV 440
            :.|:::. ..|.:|:|.:|||:|||:..||:..|:|  |.....||:|
Mouse   289 DQALYIT-EILGFSHSCLNPIIYAFVGQNFRHEFLKILANHGLVRKEV 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 61/220 (28%)
7tm_1 162..417 CDD:278431 74/268 (28%)
Cxcr1NP_839972.1 7tmA_CXCR1_2 45..321 CDD:341333 84/292 (29%)
TM helix 1 45..72 CDD:341333 10/23 (43%)
TM helix 2 79..104 CDD:341333 12/24 (50%)
TM helix 3 115..145 CDD:341333 9/29 (31%)
TM helix 4 156..178 CDD:341333 8/25 (32%)
TM helix 5 204..232 CDD:341333 10/27 (37%)
TM helix 6 240..270 CDD:341333 6/32 (19%)
TM helix 7 289..314 CDD:341333 10/25 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.