DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and Ptafr

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001074680.1 Gene:Ptafr / 19204 MGIID:106066 Length:341 Species:Mus musculus


Alignment Length:326 Identity:83/326 - (25%)
Similarity:149/326 - (45%) Gaps:45/326 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 QQNGSHYLEYDDDGPDCSYSYNFILKLITMILYALVCIIGLFGNTLVIYVVMRF--SKMQTVTNI 182
            :.|||..:       |..:.|.     :..|:|:::.|:|:..|..|::|....  ||......|
Mouse     2 EHNGSFRV-------DSEFRYT-----LFPIVYSVIFILGVVANGYVLWVFANLYPSKKLNEIKI 54

  Fly   183 YILNLAIADECFLIGIP-FLLYTMQVGNWPFGNYMCKAYMVSTSITSFTSSIFLLIMSADRYIAV 246
            :::||.:||..|||.:| :::|....|:|...|::|........|.::.|..||.:::.:||.||
Mouse    55 FMVNLTMADLLFLITLPLWIVYYYNEGDWILPNFLCNVAGCLFFINTYCSVAFLGVITYNRYQAV 119

  Fly   247 CHPISSPRYRTPFVSKLVSAFAWMTSVLLMLPVILFASTVQSSNGNVSCNIEWPDTQNSHTDSTF 311
            .:||.:.:..|......:|...|::.|......:...||....|.:.|.||..............
Mouse   120 AYPIKTAQATTRKRGISLSLIIWVSIVATASYFLATDSTNLVPNKDGSGNITRCFEHYEPYSVPI 184

  Fly   312 ILYSLVLGFATPLTFILVFYC-LVIRKLHTVGPKHKSKEKKRS-HRKVTKLVLTVISAYIFCWLP 374
            ::..:.:.|...|.|.|:||| |||  :||:..:...:::|.. .|:...:|.||::.:|.|::|
Mouse   185 LVVHVFIAFCFFLVFFLIFYCNLVI--IHTLLTQPMRQQRKAGVKRRALWMVCTVLAVFIICFVP 247

  Fly   375 HWISQV--------------ALISSAPQRCASRLELAVFLACGCLSYSNSAMNPILYAFLSDNFK 425
            |.:.|:              ..|:.|.|         :.|   ||..:|..::|::|.||:..|:
Mouse   248 HHVVQLPWTLAELGYQTNFHQAINDAHQ---------ITL---CLLSTNCVLDPVIYCFLTKKFR 300

  Fly   426 K 426
            |
Mouse   301 K 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 59/220 (27%)
7tm_1 162..417 CDD:278431 69/273 (25%)
PtafrNP_001074680.1 7tm_1 33..292 CDD:278431 69/272 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.