DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and npr-13

DIOPT Version :10

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_506659.2 Gene:npr-13 / 191160 WormBaseID:WBGene00013883 Length:450 Species:Caenorhabditis elegans


Alignment Length:32 Identity:13/32 - (40%)
Similarity:17/32 - (53%) Gaps:4/32 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 SANLHYRKKIEPSSK----KFLLNSFAKSFIV 115
            ||:||..:.||.||.    |.||..:..|.|:
 Worm    32 SASLHLSQYIETSSSYQNTKTLLRFYDPSVII 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tmA_AstC_insect 146..428 CDD:320222
TM helix 1 147..173 CDD:320222
TM helix 2 180..206 CDD:320222
TM helix 3 217..247 CDD:320222
TM helix 4 259..281 CDD:320222
TM helix 5 308..337 CDD:320222
TM helix 6 352..382 CDD:320222
TM helix 7 396..421 CDD:320222
npr-13NP_506659.2 7tmA_NPYR-like 32..330 CDD:320331 13/32 (41%)
TM helix 1 32..57 CDD:320331 11/24 (46%)
TM helix 2 63..88 CDD:320331 0/1 (0%)
TM helix 3 101..131 CDD:320331
TM helix 4 142..163 CDD:320331
TM helix 5 194..223 CDD:320331
TM helix 6 246..276 CDD:320331
TM helix 7 298..323 CDD:320331
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.