DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and P2ry1

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001268945.1 Gene:P2ry1 / 18441 MGIID:105049 Length:373 Species:Mus musculus


Alignment Length:312 Identity:87/312 - (27%)
Similarity:150/312 - (48%) Gaps:28/312 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 LYALVCIIGLFGNTLVIYVVMRFSKMQTVTNIYILNLAIADECFLIGIPFLL-YTMQVGNWPFGN 214
            :|.||.|||..||::.|::.:...|..:..::|:.|||:||..:::.:|.|: |.....:|.||:
Mouse    57 VYILVFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFGD 121

  Fly   215 YMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISS----PRYRTPFVSKLVSAFAWMTSVLL 275
            .|||.......:..:.|.:||..:||.||..|.:|:.|    .:....:||.||    |:..|:.
Mouse   122 AMCKLQRFIFHVNLYGSILFLTCISAHRYSGVVYPLKSLGRLKKKNAIYVSVLV----WLIVVVA 182

  Fly   276 MLPVILFASTVQSSNGNVSCNIEWPDTQNSHTDSTFILYSL---VLGFATPLTFILVFYCLVIRK 337
            :.|::.::.|....|..|:|   :..|.|.:..|.|| ||:   |..|..||..||..|.|:::.
Mouse   183 ISPILFYSGTGTRKNKTVTC---YDTTSNDYLRSYFI-YSMCTTVAMFCIPLVLILGCYGLIVKA 243

  Fly   338 LHTVGPKHKSKEKKRSHRKVTKLVLTVISAYIFCWLPHWIS-----QVALISSAPQRCASRLEL- 396
            |     .:...:.....||...||:.|::.:...::|..:.     :..|....|:.|.....: 
Mouse   244 L-----IYNDLDNSPLRRKSIYLVIIVLTVFAVSYIPFHVMKTMNLRARLDFQTPEMCDFNDRVY 303

  Fly   397 AVFLACGCLSYSNSAMNPILYAFLSDNFKKSFMKACTCAARK-DVNAQLQLE 447
            |.:.....|:..||.::||||....|.|::...:|...|:|: :.|.|.:.|
Mouse   304 ATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSE 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 64/223 (29%)
7tm_1 162..417 CDD:278431 71/268 (26%)
P2ry1NP_001268945.1 7tm_1 68..324 CDD:278431 71/268 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.