DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and Cx3cr1

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_598218.1 Gene:Cx3cr1 / 171056 RGDID:620137 Length:354 Species:Rattus norvegicus


Alignment Length:376 Identity:97/376 - (25%)
Similarity:165/376 - (43%) Gaps:54/376 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 MVTSVRPHLDHRNRPTQQNGSHYLEYDDDGPDCSYSYNFIL--KLITMILYALVCIIGLFGNTLV 166
            |.||. |.||..|          .||||....| |..:.:.  .:...|.|:||...||.||.||
  Rat     1 MPTSF-PELDLEN----------FEYDDSAEAC-YLGDIVAFGTIFLSIFYSLVFTFGLVGNLLV 53

  Fly   167 IYVVMRFSKMQTVTNIYILNLAIADECFLIGIPFLLYTMQVGNWPFGNYMCKAYMVSTSITSFTS 231
            :..:....|.:::|:||:||||::|..|:..:||..:.: :.:....|.|||.......|..|..
  Rat    54 VLALTNSRKSKSITDIYLLNLALSDLLFVATLPFWTHYL-ISHEGLHNAMCKLTTAFFFIGFFGG 117

  Fly   232 SIFLLIMSADRYIAVCHPISSPRYRTPFVSKLVSAFAWMTSVLLMLPVILFASTVQSSNGNVSCN 296
            ..|:.::|.|||:|:....:|...||......:|...|..::|:..|..:|  |.:..|..:...
  Rat   118 IFFITVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVASPQFMF--TKRKDNECLGDY 180

  Fly   297 IE-----WPDTQNSHTDSTFILYSLVLGFATPLTFILVFYCLVIRKLHTVGPKHKSKEKKRSHRK 356
            .|     ||..:||..:        :|||..||..:...|..::|.|.:.    |:::|.|:.| 
  Rat   181 PEVLQEIWPVLRNSEVN--------ILGFVLPLLIMSFCYFRIVRTLFSC----KNRKKARAIR- 232

  Fly   357 VTKLVLTVISAYIFCWLPH----WISQVALISSAPQRCASRLELAVFLA-CGCLSYSNSAMNPIL 416
               |:|.|:..:...|.|:    ::..:...:..|. |..:.:|...|: ...:::|:..:||.:
  Rat   233 ---LILLVVVVFFLFWTPYNIVIFLETLKFYNFFPS-CGMKRDLRWALSVTETVAFSHCCLNPFI 293

  Fly   417 YAFLSDNFKK----SFMKACTCAARKDVNAQLQLENSFFPKFGKGRQSERL 463
            |||..:.|::    .:.|.......:.|:|....|:.      :.||...|
  Rat   294 YAFAGEKFRRYLRHLYNKCLAVLCGRPVHAGFSTESQ------RSRQDSIL 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 60/220 (27%)
7tm_1 162..417 CDD:278431 67/264 (25%)
Cx3cr1NP_598218.1 7tm_1 49..294 CDD:278431 67/264 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.