DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and Cysltr2

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_596904.1 Gene:Cysltr2 / 170926 RGDID:619797 Length:309 Species:Rattus norvegicus


Alignment Length:282 Identity:76/282 - (26%)
Similarity:133/282 - (47%) Gaps:17/282 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 ILYALVCIIGLFGNTLVIYVVMRFSKMQTVTNIYILNLAIADECFLIGIPFLL-YTMQVGNWPFG 213
            |:|.::.:.|..||...|||.::..|..|..|:::|||||:|..|:..:||.. |..:..:|.||
  Rat    27 IIYLIIFVWGALGNGFSIYVFLQTYKKSTSVNVFMLNLAISDFLFISTLPFRADYNFRGSDWIFG 91

  Fly   214 NYMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTPFVSKLVSAFAWMTSVLLMLP 278
            ::.|:....|..:..:||..||.::|..|::|..||.......:...:.::....|   |.:|..
  Rat    92 DWACRIMSYSLYVNMYTSIYFLTVLSIVRFLATAHPFQMLHITSVRSAWILCGIIW---VFIMAS 153

  Fly   279 VILFASTVQSSNGNVSCNIEWPDTQNSHTDSTFILYSLV---LGFATPLTFILVFYCLVIRKLHT 340
            ..|.....|....|.:...|    .|.......::.:.:   :||..|...:.:.|.|:||.|..
  Rat   154 SGLLLKHGQEKKNNTTLCFE----LNLQKFKNLVILNYIALGVGFLLPFFILTICYLLIIRVLLK 214

  Fly   341 VG-PKHKSKEKKRSHRKVTKLVLTVISAYIFCWLP-HWISQVALISSAPQRCASRLELAVFLACG 403
            |. |:...::.:|  :.:|.:|:.:| .::.|:|| |.:..:.|::.....|...|..|..:.. 
  Rat   215 VEIPESGPRDAQR--KALTTIVIAMI-IFLLCFLPYHALRTIHLVTWDADSCMDELHKATVITL- 275

  Fly   404 CLSYSNSAMNPILYAFLSDNFK 425
            .|:.:||..||.||.|..:|||
  Rat   276 TLAAANSCFNPFLYYFAGENFK 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 55/220 (25%)
7tm_1 162..417 CDD:278431 67/260 (26%)
Cysltr2NP_596904.1 TAS2R 24..247 CDD:283059 59/229 (26%)
7tm_1 39..289 CDD:278431 67/260 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.