DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and CX3CR1

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001164645.1 Gene:CX3CR1 / 1524 HGNCID:2558 Length:387 Species:Homo sapiens


Alignment Length:311 Identity:86/311 - (27%)
Similarity:145/311 - (46%) Gaps:33/311 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 EYDDDGPDCSYSYNFIL--KLITMILYALVCIIGLFGNTLVIYVVMRFSKMQTVTNIYILNLAIA 190
            ||||....| |..:.::  .:...|.|:::..|||.||.||::.:....|.::||:||:||||::
Human    45 EYDDLAEAC-YIGDIVVFGTVFLSIFYSVIFAIGLVGNLLVVFALTNSKKPKSVTDIYLLNLALS 108

  Fly   191 DECFLIGIPFLLYTMQVGNWPFGNYMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRY 255
            |..|:..:||..:.: :......|.|||.......|..|.|..|:.::|.|||:|:....:|...
Human   109 DLLFVATLPFWTHYL-INEKGLHNAMCKFTTAFFFIGFFGSIFFITVISIDRYLAIVLAANSMNN 172

  Fly   256 RTPFVSKLVSAFAWMTSVLLMLPVILFASTVQSSNGNVSCNIE-----WPDTQNSHTDSTFILYS 315
            ||......:|...|..::|:..|..:|  |.|..|..:....|     ||..:|..|:       
Human   173 RTVQHGVTISLGVWAAAILVAAPQFMF--TKQKENECLGDYPEVLQEIWPVLRNVETN------- 228

  Fly   316 LVLGFATPLTFILVFYCLVIRKLHTVGPKHKSKEKKRSHRKVTKLVLTVISAYIFCWLPH----W 376
             .|||..||..:...|..:|:.|.:.        |.....|..||:|.|:..:...|.|:    :
Human   229 -FLGFLLPLLIMSYCYFRIIQTLFSC--------KNHKKAKAIKLILLVVIVFFLFWTPYNVMIF 284

  Fly   377 ISQVALISSAPQRCASRLELAVFLA-CGCLSYSNSAMNPILYAFLSDNFKK 426
            :..:.|....|. |..|.:|.:.|: ...:::|:..:||::|||..:.|::
Human   285 LETLKLYDFFPS-CDMRKDLRLALSVTETVAFSHCCLNPLIYAFAGEKFRR 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 63/220 (29%)
7tm_1 162..417 CDD:278431 71/264 (27%)
CX3CR1NP_001164645.1 7tm_1 80..325 CDD:278431 71/264 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.